Recombinant Human Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase (ST3GAL3) Protein (His-SUMO)

Name: Recombinant Human Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase (ST3GAL3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04377P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase (ST3GAL3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q11203
Target Symbol	ST3GAL3
Synonyms	3 sialyltransferase; 3(4) GlcNAc alpha-2; 3-sialyltransferase 3; 3-sialyltransferase; 3-ST 3; 4-galactoside alpha-2; 4GlcNAc alpha 2 3 sialyltransferase; Alpha 2 3 sialyltransferase II; Alpha 2 3 sialyltransferase III; Alpha 2 3 ST 3; Alpha 2; Beta galactoside alpha 3 sialyltransferase 3; Beta-galactoside alpha-2; CMP N acetylneuraminate beta 1 4 galactoside alpha 2 3 sialyltransferase; CMP-N-acetylneuraminate-beta-1; EC 2.4.99.6; Gal beta 1 3; Gal beta 1 3(4) GlcNAc alpha 2 3 sialyltransferase; Gal beta 1 3(4)GlcNAc alpha 2 3 sialyltransferase; Gal beta-1; N acetyllactosaminide alpha 2 3 sialyltransferase; N-acetyllactosaminide alpha-2; OTTHUMP00000008820; OTTHUMP00000008821; OTTHUMP00000008822; OTTHUMP00000008823; Sialyltransferase 6 (N acetyllacosaminide alpha 2 3 sialyltransferase); Sialyltransferase 6; SIAT6; SIAT6_HUMAN; ST3 beta galactoside alpha 2 3 sialyltransferase 3; ST3 beta galactoside alpha 2,3 sialyltransferase 3; ST3Gal III; St3gal3; ST3GALII; ST3GalIII; ST3N
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Expression Range	29-375aa
Protein Length	Partial
Mol. Weight	54.9kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
Subcellular Location	Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
Protein Families	Glycosyltransferase 29 family
Database References	HGNC: 10866 OMIM: 606494 KEGG: hsa:6487 UniGene: PMID: 27535614 ST3Gal3 knockdown synergistically enhanced cisplatin-induced apoptosis in ovarian cancer cells PMID: 27871859 ST3Gal III modulates breast cancer cell adhesion and invasion by altering the expression of invasion-related molecules. PMID: 27779707 Dysfunctional ST3GAL3 may result in perturbation of the posttranslational sialylation of proteins in these pathways PMID: 23252400 ST3GAL3 mutations impair the development of higher cognitive functions. PMID: 21907012 Characterization of the promoter region of the ST3Gal III gene. PMID: 12697334 19 different transcripts of ST3GalIII were isolated and cloned; tissue distribution analysis showed complex patterns in neural and muscular tissues PMID: 12815231 High levels of ST3GAL-III in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012). PMID: 12931020 Identification of a new ST3Gal3 transcript from fetal brain. PMID: 15316282

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.