Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11065P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11065P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P26441 |
Target Symbol | CNTF |
Synonyms | Ciliary neurotrophic factor; CNTF; CNTF_HUMAN; HCNTF |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Expression Range | 1-200aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 26.8 |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
Subcellular Location | Cytoplasm. |
Protein Families | CNTF family |
Database References | HGNC: 2169 OMIM: 118945 KEGG: hsa:1270 STRING: 9606.ENSP00000355370 UniGene: PMID: 29564604 |