Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08411P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08411P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ciliary Neurotrophic Factor (CNTF) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P26441 |
| Target Symbol | CNTF |
| Synonyms | Ciliary neurotrophic factor; CNTF; CNTF_HUMAN; HCNTF |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN |
| Expression Range | 4-196aa |
| Protein Length | Partial |
| Mol. Weight | 26.1kDa |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
| Subcellular Location | Cytoplasm. |
| Protein Families | CNTF family |
| Database References | HGNC: 2169 OMIM: 118945 KEGG: hsa:1270 STRING: 9606.ENSP00000355370 UniGene: PMID: 29564604 |
