Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00051P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00051P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P08861 |
| Target Symbol | CELA3B |
| Synonyms | CELA3B; ELA3B; Chymotrypsin-like elastase family member 3B; EC 3.4.21.70; Elastase IIIB; Elastase-3B; Protease E |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
| Expression Range | 29-270aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 30.0 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Efficient protease with alanine specificity but only little elastolytic activity. |
| Protein Families | Peptidase S1 family, Elastase subfamily |
| Database References | HGNC: 15945 KEGG: hsa:23436 STRING: 9606.ENSP00000338369 UniGene: PMID: 30106003 |
