Recombinant Human Chymase (CMA1) Protein (His)

Name: Recombinant Human Chymase (CMA1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04107P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Chymase (CMA1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P23946
Target Symbol	CMA1
Synonyms	Alpha-chymase; Chymase 1; Chymase 1 mast cell; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; Chymase; Chymase; heart; Chymase; mast cell; CMA1; CMA1_HUMAN; CYH; CYM; EC 3.4.21.39; Mast cell chymase 1; Mast cell protease 3; Mast cell protease 5; Mast cell protease I; Mast cell protease III; Mcp-5; MCP3P; Mcpt5; MCT1; MGC119890; MGC119891; MMCP-5
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Expression Range	22-247aa
Protein Length	Full Length of Mature Protein
Mol. Weight	29.0kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Subcellular Location	Secreted. Cytoplasmic granule. Note=Mast cell granules.
Protein Families	Peptidase S1 family, Granzyme subfamily
Database References	HGNC: 2097 OMIM: 118938 KEGG: hsa:1215 STRING: 9606.ENSP00000250378 UniGene: PMID: 28205588 Cleavage of the alarmins by Human mast cell chymase and human neutrophil cathepsin G suggests a function in regulating excessive inflammation. PMID: 28053237 activation of endothelial CLP/chymase may directly relate to the increased inflammatory phenotypic changes in the vascular system in women with preeclampsia PMID: 19494363 Placenta-derived chymotrypsin-like protease contributes to the altered endothelial barrier function in preeclampsia. PMID: 19126871 promoter single nucleotide polymorphism is not associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines PMID: 25797204 Our data demonstrated that mast cell chymase plays an important role in keloid formation through TGF-beta1/Smad signaling pathway. PMID: 25120737 These data suggest a possible contribution of human chymase activation to LPS-induced mortality PMID: 24516344 we present data indicating that MC tryptase and chymase contribute to the development of OSF and malignant transformation of the overlying epithelium. PMID: 24874976 The polymorphisms and haplotypes of the CMA1 locus are associated with cardiac hypertrophy in male patients with symptomatic aortic stenosis. PMID: 24823657 CMA1 gene single nucleotide polymorphisms is associated with essential hypertension. PMID: 25119908 Significant association between the AG genotype of CMA1 A polymorphism and Angina Pectoris and Ventricular Extrasystoles was observed. PMID: 25102745 The accumulated data in this review suggest that mast cells, their tryptases, and their chymases play important roles in tissue repair. PMID: 24507159 demonstrate the generation of Pso p27 from SCCA1 with extracts from psoriatic scale and even more remarkably, the generation of Pso p27 from SCCA1 in the presence of mast cell associated chymase PMID: 24560885 The present results indicated PRCP rs7104980 can be considered as a marker for EH and Hap3 GAGCACTAACA (PRCP) and Hap16 TTTA (CMA1) might be associated with essential hypertension in Chinese Han population. PMID: 22679278 Purified chymase mixed with fragmented heparin derived from heparanase-expressing cells show greater release from collagen gels than the enzyme alone or mixed with macromolecular heparin derived from mock cells. PMID: 24344642 Data indicate that the best Fynomer (the binding proteins derived from the Fyn SH3 domain) was found to bind chymase with a KD of 0.9 nM and koff of 6.6x10 (-4) s (-1) , and to selectively inhibit chymase activity with an IC 50 value of 2 nM. PMID: 22653218 Both IgE and chymase associate with diabetes status. PMID: 22194960 As mast cells are an important source of VEGF, tryptase, and chymase, these findings suggest that mast cell activation and mast cell-derived mediators participate in the development of Dengue hemorrhagic fever. PMID: 22363824 Chymase rs1800875 polymorphism is associated with the progression of immunoglobulin A (IgA) nephropathy in Korean patients. PMID: 21150220 a dominant role of cardiac chymase in the formation of Ang II from Ang-(1-12) PMID: 22180785 Two different populations of mast cells were found in melanocytic skin; one expressing both chymase and tryptase and the other with tryptase only. PMID: 22102069 mast cell-derived protein is present in uterine cervical carcinoma PMID: 21274549 Polymorphism rs1800875 of CMA1 may be associated with serum IgE level in coronary heart disease subjects, but not with chymase level in normal coronary intimae PMID: 21796807 human chymase contributes to blood glucose levels and mortality during the progression of diabetes PMID: 21786536 short tandem repeat genetic polymorphism is associated with bronchial asthma in a Swiss cohort study PMID: 20736038 Elevated maternal chymase activity and enhanced protease immunostaining in the maternal vessel endothelium may constitute the exacerbated inflammatory state and account for the increased vascular Ang II sensitivity in preeclampsia. PMID: 20670150 Positions 143 (Arg) and 192 (Lys) in human mast cell chymase contribute to the strong preference for negatively charged amino acids at substrate position P2'. PMID: 20423454 The levels of tryptase and chymase expression are greatly increased in human lung tissue of anaphylactic shock. PMID: 19697770 The S1 primary specificity pocket defines substrate specificity of chymases. PMID: 11852067 The mast cell chymase A3255 allele was shown to have an effect on HDL cholesterol metabolism. PMID: 12047032 The local release of mast cell chymase has potentially profound effects on airway smooth muscle cell function by disruption of the cell-associated matrix and inhibition of epidermal growth factor-induced smooth muscle cell proliferation. PMID: 12097409 Results suggest the additive effect of angiotensin I-converting enzyme (ACE) and heart chymase (CMA) gene polymorphisms on the increase in left ventricular mass in NIDDM patients. PMID: 12165749 Chymase may play a role in heart remodeling by increasing Ang II formation and activating MMP-9, and the regulation of collagen I gene expression. PMID: 12359984 Both the ACE and chymase-like enzyme activities in the aneurysmal aortae were significantly higher than those in the control aortae. PMID: 12484503 Degradation of phospholipid transfer protein (PLTP) and PLTP-generated pre-beta-high density lipoprotein by this enzyme in mast cells impairs high affinity efflux of cholesterol from macrophage foam cells. PMID: 12531890 Interactions among the loops bordering and defining the active site appear to influence both the zymogen and the activated conformations of chymase in this model. PMID: 12614156 albumin is a substrate of human chymase PMID: 12815038 new class of chymase inhibitor through a substituent analysis of MWP00965 chemically synthesized PMID: 14592513 chymase depletes pre-beta-high density lipoprotein, which impairs ATP-binding cassette transporter A1- but not scavenger receptor class B type I-mediated lipid efflux to high density lipoprotein PMID: 14701812 MCT1 immunoreactivity was visible in blood vessel walls as early as the 13th week of gestation mainly in the visual cortical plate and subplate. PMID: 14757520 mast cell chymase-1 is unlikely to influence blood pressure levels in the Japanese population. PMID: 15106801 Bladder fibrosis may be mediated by mast cell chymase stimulation of collagen synthesis. PMID: 15227657 The synthesis of new potential inhibitors of human chymase is described PMID: 15449728 Tryptase and chymase and protein levels were determined in mast cells in fibrosarcoma. PMID: 15638376 mast cell chymase activates ERK and p38 probably through G-protein-coupled receptor, and the ERK but not p38 cascade may have a crucial role in chymase-induced migration of eosinophils PMID: 15919053 A novel (TG)n(GA)m repeat polymorphism 254 bp downstream of the mast cell chymase (CMA1) gene is associated with atopic asthma and total serum IgE levels. PMID: 15924217 Chymase-induced apoptosis of conjunctival epithelial cells represents anoikis, which is a slowly occurring apoptotic process induced by lack of adhesion to an extracellular matrix. PMID: 16020275 Significant association between the CMA1 promoter polymorphism rs1800875 and atopic eczema supports the hypothesis that CMA1 serves as candidate gene for atopic eczema. PMID: 16134991 activated human skin mast cells (MCs) convert CTAP-III into biologically active NAP-2 through proteolytic cleavage by released chymase. PMID: 16317101 The CMA1 polymorphisms studied do not contribute to disease susceptibility in Japanese or Dutch sarcoidosis patients. PMID: 16446531

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.