Recombinant Human Chromogranin-A (CHGA) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08142P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Chromogranin-A (CHGA) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08142P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Chromogranin-A (CHGA) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P10645
Target Symbol CHGA
Synonyms beta Granin; betagranin (N-terminal fragment of chromogranin A); catestatin; CgA; CHG A; Chga; chromofungin; Chromogranin A; Chromogranin A parathyroid secretory protein 1; Chromogranin A precursor; ChromograninA; CMGA_HUMAN; ER-37; Pancreastatin; Parastatin; Parathyroid secretory protein 1; Pituitary secretory protein I; Secretory protein I; SP I; SP-I; SP1; SPI; vasostatin 2; Vasostatin; Vasostatin I; Vasostatin II; vasostatin-2
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Expression Range 224-457aa
Protein Length Partial
Mol. Weight 53.4kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Strongly inhibits glucose induced insulin release from the pancreas.; Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa. Can induce mast cell migration, degranulation and production of cytokines and chemokines. Acts as a potent scavenger of free radicals in vitro. May play a role in the regulation of cardiac function and blood pressure.; Regulates granule biogenesis in endocrine cells by up-regulating the transcription of protease nexin 1 (SERPINE2) via a cAMP-PKA-SP1 pathway. This leads to inhibition of granule protein degradation in the Golgi complex which in turn promotes granule formation.
Subcellular Location [Serpinin]: Secreted. Cytoplasmic vesicle, secretory vesicle.; Cytoplasmic vesicle, secretory vesicle. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle. Secreted.
Protein Families Chromogranin/secretogranin protein family
Database References

HGNC: 1929

OMIM: 118910

KEGG: hsa:1113

STRING: 9606.ENSP00000216492

UniGene: PMID: 29858590

  • Patients with higher catestatin levels developed worse ventricular function during the follow-up period. Single-point catestatin was effective to predict LVEDD change. And concurrently increasing catestatin and NT-proBNP levels predicted the highest risk of LV remodeling. This study suggests an important prognostic information of catestatin on LV remodeling. PMID: 28397784
  • CgA and NSE are clinically valuable tumor markers in neuroblastoma and they merit prospective clinical evaluations as such. PMID: 29737901
  • Vasostatin-1 is stably overexpressed in serum of patients with ileal and pancreatic neuroendocrine neoplasms. PMID: 29723285
  • Results suggest that severe atopic dermatitis is associated with higher stress levels. Simple salivary CgA measurements may be useful as an objective assessment of patient stress. PMID: 28406540
  • cardiac atria express but do not secrete CgA into circulation in patients with atrial disease PMID: 28685598
  • These results suggest that circulating full-length CgA is an important inhibitor of angiogenesis and tumor growth, and that cleavage of its C-terminal region markedly reduces its activity. Pathophysiological changes in CgA blood levels and/or its fragmentation might regulate disease progression in cancer patients. PMID: 27683038
  • Results show that chronic lymphocytic leukemia (CLL) patients had increased plasma levels of chromogranin A (CgA), compared to normal subjects, particularly those >70-year-old or those treated with proton pump inhibitors. PMID: 27203389
  • The authors show that CHGA-415 T/C polymorphism is an independent risk factor of poor prognosis in critically ill patients PMID: 28254729
  • Concurrent increases in plasma BNP (B-type natriuretic peptide) and CST levels predicted the highest risk for both all-cause and cardiac deaths in chronic heart failure patients. PMID: 27771336
  • Full-length CgA is an independent indicator of atherosclerotic plaques in carotid artery stenosis. PMID: 28190616
  • Even a single baseline measurement of CgA can be useful in establishing prognosis in this group, if this parameter exceeds its upper normal limit more than tenfold. PMID: 28095720
  • Compared with chromogranin A, chromogranin B may be more useful during proton pump inhibitor treatment and can detect tumors without liver metastases. PMID: 28334992
  • Salivary impairments and high levels of CHGA are associated with T2DM patients. In addition, CGHA polymorphisms might be associated with salivary gland hypofunction and higher salivary CHGA production in T2DM patients. This could be a significant insight to establish a role for salivary CHGA as a potential clinical biomarker to T2DM. PMID: 26750135
  • we could provide evidence that established stress-related biomarkers ET-1, MCP-1, CGA were differentially regulated among patients with AF compared to healthy controls. PMID: 28886122
  • Combined plasma CgA concentrations and World Health Organization grading may assist in better stratification of PNET patients in terms of the risk of recurrence. PMID: 28043759
  • Metastatic castration-resistant prostate cancer patients with an early high CGA rise may demonstrate a subgroup with poor outcome due to underlying small cell/neuroendocrine cell transformation. PMID: 28870943
  • genetic association studies in population in India: Data suggest that common polymorphisms (SNPs) in CHGA promoter are associated with cardiometabolic disorders; c-Rel has a role in activating CHGA promoter haplotype 2 (variant T alleles at -1018 and -57 bp) under basal and pathophysiological conditions. (CHGA = chromogranin A; c-Rel = c-Rel proto-oncogene protein) PMID: 28667172
  • Multivariate analyses of nonfunctional pancreatic neuroendocrine tumor patients with both grade and CgA recorded found poorly differentiated tumors and very high CgA negatively impacted survival. PMID: 28501118
  • High chromogranin A expression is associated with neuroendocrine differentiation in colorectal cancer. PMID: 28351413
  • Catestatin Gly364Ser Variant Alters Systemic Blood Pressure and the Risk for Hypertension in Human Populations via Endothelial Nitric Oxide Pathway. PMID: 27324226
  • Plasma catestatin was associated with coronary collateral developments, suggesting a useful biomarker for coronary collateral development and potential target for therapeutic angiogenesis in patients with coronary artery chronic total occlusions (CTO). PMID: 27304618
  • Increased myocardial CgA glycosylation and impaired CgA processing to catestatin in heart failure be considered detrimental because CST reduces diastolic Ca2+ leak via direct CaMKIIdelta inhibition. PMID: 28209766
  • Data suggest pancreastatin, a 49 residue post-translational fragment of chromogranin A, as a routinely tested biomarker in neuroendocrine tumors (NETs) and in particular small bowel NET. PMID: 26684860
  • Data indicate that measurement of chromogranin A (CgA) alone is sufficient in the management of patients with neuroendocrine tumours (NETs) and that routine additional measurement of chromogranin B (CgB) provides little added value. PMID: 26608723
  • Data show that chrysin suppressed cell proliferation and reducing expression of achaete-scute complex-like 1 (ASCL1) and the neuroendocrine biomarker chromogranin A (CgA). PMID: 26403073
  • In a Japanese population, the Ser-364 allele was associated with elevated systolic blood pressure and pulse pressure, consistent with increased arterial stiffness. PMID: 26211667
  • ChrA levels were not effective in predicting outcomes or detecting recurrences of Merkel cell carcinoma. PMID: 26299616
  • Decreased CSF levels of chromogranin A were found in Parkinson disease patients with orthostatic hypotension. PMID: 26359267
  • In both mice and men the Gly364Ser polymorphism conferred metabolic traits such as elevated HDL and lowered norepinephrine levels; it was associated with superior baroreflex function and therefore better response to stress. PMID: 26556564
  • In patients with resected pancreatic neuroendocrine tumors, an elevated preoperative CgA level was negatively associated with disease-free survival and overall survival. PMID: 26850182
  • In astrocytes from multiple sclerosis white matter lesions the expression of chromogranin A is increased. PMID: 26683597
  • Receiver operating characteristic analyses showed that ChgA autoantibodies are valuable in the predictive diagnosis of non-small cell lung cancer (NSCLC), suggesting that serum autoantibodies to ChgA-derived peptides are promising novel markers of NSCLC PMID: 26186986
  • Diagnostic value of circulating chromogranin a for neuroendocrine tumors PMID: 25894842
  • Data indicate that ADP-ribosylation factor 1 (Arf1) colocalizes with chromogranin A and regulates secretion of insulin like growth factor 1 (IGF-1) and is required for anchorage dependent growth. PMID: 25754106
  • catestatin plays an important role in the progress of acute myocardial infarction PMID: 25848973
  • The CHGA 3'-UTR C+87T disrupts an miR-107 motif, with differential effects on CHGA expression, and a cis:trans (mRNA:miR) interaction regulates the association of CHGA with BP and hypertensive nephropathy. PMID: 25392232
  • Chromogranin A measurements are significantly assay-dependent and caution should be applied in the interpretation of CgA measurement for assessment of neuroendocrine tumor status. PMID: 25532001
  • Chromogranin A (10-19) and chromogranin A (43-52) were identified as antigens for autoreactive CD8(+) T cells in Type 1 diabetes patients. PMID: 25958206
  • Vasoconstriction-Inhibiting Factor (VIF), a degradation product of chromogranin A, is a vasoregulatory peptide that modulates the vasoconstrictive effects of angiotensin II by acting on the angiotensin II type 2 receptor. PMID: 25810338
  • Patients with irritable bowel syndrome present a low density of CgA compared with controls. PMID: 25174455
  • Report QT/heart rate variability in a genomically "humanized" chromogranin a monogenic mouse model with hyperadrenergic hypertension. PMID: 24821335
  • Report fast and reliable measurement of chromogranin A with automated KRYPTOR assay. PMID: 25651748
  • The study shows that chromogranin A is a useful marker for diagnosing pancreatic neuroendocrine tumors (pNET) in Japanese populations and for distinguishing patients with pNET from patients with other pancreatic diseases. PMID: 25220535
  • reliable pathologic and circulating maker for diagnosis of gastroenteropancreatic neuroendocrine neoplasm PMID: 25501094
  • a model to explain how the chromogranin A/Catecholamine complex governs the accumulation and exocytosis of secreted amines PMID: 25077558
  • High serum Chromogranin A levels are associated with low response to chemotherapy in metastatic castration-resistant prostate cancer. PMID: 24741024
  • Elevated plasma catestatin levels are predictive of malignant arrhythmia in patients with acute myocardial infarction. PMID: 24631953
  • Letter: report diagnostic role of chromogranin A immunohistochemistry in hyalinizing trabecular tumor of the thyroid. PMID: 25012947
  • High serum Chromogranin A levels are associated with pancreatic neuroendocrine tumors. PMID: 25099181
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed