Recombinant Human Choline Transporter-Like Protein 4 (SLC44A4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00451P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Choline Transporter-Like Protein 4 (SLC44A4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00451P
Regular price
$54900
$549.00
Sale price$29900
$299.00Save $250
/
Product Overview
Description | Recombinant Human Choline Transporter-Like Protein 4 (SLC44A4) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q53GD3 |
Target Symbol | SLC44A4 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | WLYGDPRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSW |
Expression Range | 56-229aa |
Protein Length | Partial |
Mol. Weight | 26.7 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Choline transporter that plays a role in the choline-acetylcholine system and is required to the efferent innervation of hair cells in the olivocochlear bundle for the maintenance of physiological function of outer hair cells and the protection of hair cells from acoustic injury. Also described as a thiamine pyrophosphate transporter in colon, may mediate the absorption of microbiota-generated thiamine pyrophosphate and contribute to host thiamine (vitamin B1) homeostasis.; Has also thiamine pyrophosphate transporter activity. |
Subcellular Location | Membrane; Multi-pass membrane protein. Apical cell membrane. |
Protein Families | CTL (choline transporter-like) family |
Database References | |
Associated Diseases | Deafness, autosomal dominant, 72 (DFNA72) |
Tissue Specificity | Highly expressed in colon, also detected in prostate, trachea and lung. Isoform 3 is also expressed in colon but a lower levels. |
Gene Functions References
- We found that rs2736428 was significantly associated with UC risk (allelic p = 0.0004), and the CT and TT genotypes of rs2736428 had a higher distribution compared with the CC genotypes (genotypic p = 0.001), suggesting that the T allele was a risk allele (odds ratio = 1.45, 95% confidence interval = 1.18-1.78). Moreover, one haplotype block that included rs2736428 was found to be strongly associated with UC risk as well PMID: 28753073
- Whole-exome sequencing revealed SLC44A4, which encodes the choline transport protein, as the pathogenic gene in this family. In the zebrafish model, downregulation of slc44a4 using morpholinos led to significant abnormalities in the zebrafish inner ear and lateral line neuromasts and contributed, to some extent, to disabilities in hearing and balance. PMID: 28013291
- These results suggest (i) apparent allelic heterogeneity in CFB and genetic heterogeneity in SLC44A4 across different ethnic groups; (ii) shared ulcerative colitis genetic etiological factors among Asians PMID: 27759029
- Critical genetic polymorphisms in SLC44A4, an ulcerative colitis susceptibility gene, have been identified in a genetic association study in North Indians. PMID: 26741288
- epigenetic mechanisms (histone modifications) play a role in determining the tissue-specific pattern of expression of the TPPT along the GI tract. PMID: 26901654
- The results also provide an indirect support for a membrane topology for hTPPT with 10 transmembrane domains as predicted by the TMHMM transmembrane helixes prediction program. PMID: 26828122
- Characterization of the SLC44A4 promoter and report the importance of both ELF3 and CREB-1 transcription factors in the maintenance of basal promoter activity in colonic epithelial cells. PMID: 25715703
- Molecular identification and functional characterization of the human colonic thiamine pyrophosphate transporter. PMID: 24379411
- These results indicate that CTL4 mediates ACh synthesis in non-neuronal cell lines and presents a mechanism to target non-neuronal ACh synthesis without affecting neuronal ACh synthesis. PMID: 23651124
- These results suggest that eltrombopag can partially modulate some immune responses by TGFbeta(1) and sCTLA-4, but it does not induce immune tolerance by 24 weeks after treatment. PMID: 22789125