Recombinant Human Chemokine-Like Receptor 1 (CMKLR1) Protein (His-GST&Myc)

Beta LifeScience SKU/CAT #: BLC-06416P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Chemokine-Like Receptor 1 (CMKLR1) Protein (His-GST&Myc)

Beta LifeScience SKU/CAT #: BLC-06416P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Chemokine-Like Receptor 1 (CMKLR1) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q99788
Target Symbol CMKLR1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His-GST&C-Myc
Target Protein Sequence QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
Expression Range 321-373aa
Protein Length Partial
Mol. Weight 41.3 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 initiates activation of G proteins G(i)/G(o) and beta-arrestin pathways inducing cellular responses via second messenger pathways such as intracellular calcium mobilization, phosphorylation of MAP kinases MAPK1/MAPK3 (ERK1/2), TYRO3, MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis PubMed:27716822. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF-kappa-B. Positively regulates adipogenesis and adipocyte metabolism.; (Microbial infection) Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2).
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database References

HGNC: 2121

OMIM: 602351

KEGG: hsa:1240

STRING: 9606.ENSP00000311733

UniGene: PMID: 29430984

  • CMKLR1 and GPR1 were widely expressed in vascular smooth muscle. PMID: 27742615
  • Both ALX and ChemR23 were present in human synovium and medial tibial plateau bone obtained following total knee replacement surgery for osteoarthritis. PMID: 27860453
  • Results show that ChemR23 is highly expressed in squamous oesophageal cancer tumors and cell lines. PMID: 27092781
  • CMKLR1 exacerbated the proliferation and migration of VSMCs by activating ERK1/2. PMID: 27792688
  • We demonstrated that chemerin is linked to metabolic syndrome components. Moreover, serum chemerin levels were associated significantly with obesity, especially visceral adipose tissue, in subjects with T2DM [type 2 diabetes mellitus]. PMID: 28120562
  • Study shows that hepatic CMKLR1 mRNA is weakly associated with features of NASH in male patients only. PMID: 27548138
  • Our results show that higher levels of circulating chemerin, CRP, fibrinogen, and ESR are associated with an increased risk of developing colorectal cancer PMID: 26628300
  • Data show inverse Relationship of the CMKLR1 Relative Expression and Chemerin Serum Levels in Obesity with Dysmetabolic Phenotype and Insulin Resistance PMID: 27239101
  • Results indicate that Abeta42 activates CMKLR1, leading to glia cell migration and clearance of Abeta42; and is involved in Abeta processing and clearance PMID: 25079809
  • Gestational obesity and gestational diabetes mellitus may contribute to elevated serum chemerin. Serum chemerin in pregnancy was associated with insulin resistance and triglycerides. Chemerin gene may play a role both in obese and gestational diabetes mellitus patients PMID: 25627894
  • Increased chemerin expression in dermal blood vessels may be associated with the development of digital ulcers in systemic sclerosis. PMID: 25539827
  • The study for the first time confirmed a marked expression of chemerin and CMKLR1 in the liver of chronic hepatitis patients. PMID: 25121101
  • ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages. PMID: 25637017
  • The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported. PMID: 25030943
  • Results lend some support to a presumable role of locally produced chemerin in the progression of atherosclerotic lesions, possibly acting through its CMKLR1 receptor. PMID: 24779513
  • This study identified the up-regulation of ChemR23 in post-traumatic injury of calcaneal articular fracture PMID: 24689495
  • ChemR23 is expressed in neutrophil granules and rapidly upregulated upon neutrophil activation. PMID: 23999103
  • Development of a membrane-anchored chemerin receptor agonist as a novel modulator of allergic airway inflammation and neuropathic pain. PMID: 24659779
  • Chemerin receptor showed increased expression in the lymph nodes and the spleen. PMID: 23904282
  • Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1. PMID: 23495698
  • review of current research on biological roles of chemerin and chemokine-like receptor 1; highlight roles in mediating obesity and development of type 2 diabetes [REVIEW] PMID: 22610747
  • The interaction of chemerin and ChemR23 may play an important role in the pathogenesis of rheumatoid arthritis through the resultant activation of fibroblast-like synoviocytes. PMID: 21959042
  • These results rule out the direct anti-inflammatory effect of chemerin on macrophages ex vivo, described previously in the literature, despite the expression of a functional ChemR23 receptor in these cells. PMID: 22768214
  • Chemerin, a ligand for the G-protein coupled receptor chemokine-like receptor 1, requires carboxy-terminal proteolytic processing to unleash its chemoattractant activity PMID: 21715684
  • The ChemR23/Chemerin axis may have a role in the recruitment of dendritic cells within the kidney in patients affected by lupus nephritis. PMID: 21346723
  • A genetic variation in the chemokine-like receptor 1 (CMKLR1) gene was statistically significantly associated with decreased overall survival in the three individual populations as well as in pooled analyses. PMID: 21483023
  • These results demonstrate that human chondrocytes express both the receptor ChemR23 and the ligand chemerin...which may play pivotal roles in joint inflammation. PMID: 21192818
  • the presence of ChemR23 in human endothelial cells, its significant up-regulation by pro-inflammatory cytokines, and its role in angiogenesis were demonstrated. PMID: 20044979
  • RvE1 initiates direct activation of ChemR23 and signals receptor-dependent phosphorylation PMID: 19906641
  • ChemR23 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB PMID: 15753205
  • The results strongly support that the chemerin receptor, in the presence of CD4, functions as a "minor co-receptor" promoting infection by HIV-1, HIV-2 and SIV. PMID: 16904155
  • CMKLR1 is expressed by circulating pDC in normal individuals and patients suffering from skin diseases, such as psoriasis and atopic dermatitis. PMID: 19168032
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed