Recombinant Human Charged Multivesicular Body Protein 5 (CHMP5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10149P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Charged Multivesicular Body Protein 5 (CHMP5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10149P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Charged Multivesicular Body Protein 5 (CHMP5) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NZZ3 |
| Target Symbol | CHMP5 |
| Synonyms | apoptosis-related protein PNAS-2; C9orf83; CGI 34; Charged multivesicular body protein 5; CHMP 5; CHMP family; member 5; chmp5; CHMP5_HUMAN; Chromatin modifying protein 5; Chromatin-modifying protein 5; Chromosome 9 open reading frame 83; HGNC:26942; HSPC177; hVps60; PNAS 2; SNF7 domain containing protein 2; SNF7 domain-containing protein 2; SNF7DC2; Vacuolar protein sorting 60; Vacuolar protein sorting-associated protein 60; Vps60 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS |
| Expression Range | 1-219aa |
| Protein Length | Full Length |
| Mol. Weight | 40.6kDa |
| Research Area | Transport |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release. |
| Subcellular Location | Cytoplasm, cytosol. Endosome membrane; Peripheral membrane protein. Note=Localizes to the midbody of dividing cells. Localized in two distinct rings on either side of the Fleming body. |
| Protein Families | SNF7 family |
| Database References | HGNC: 26942 OMIM: 610900 KEGG: hsa:51510 STRING: 9606.ENSP00000223500 UniGene: PMID: 26821576 |
