Recombinant Human Charged Multivesicular Body Protein 2B (CHMP2B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08653P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Charged Multivesicular Body Protein 2B (CHMP2B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08653P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Charged Multivesicular Body Protein 2B (CHMP2B) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9UQN3 |
Target Symbol | CHMP2B |
Synonyms | ALS17; Charged multivesicular body protein 2b; CHM2B_HUMAN; CHMP family; member 2B; CHMP2.5; CHMP2b; Chromatin modifying protein 2b; Chromatin-modifying protein 2b; DMT1; hVps2-2; Vacuolar protein sorting 2; yeast; homolog of; B; Vacuolar protein sorting 2-2; Vacuolar protein sorting-associated protein 2-2; VPS2 homolog B; Vps2-2; VPS2B |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Expression Range | 1-213aa |
Protein Length | Full Length |
Mol. Weight | 50.8kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. |
Subcellular Location | Cytoplasm, cytosol. Late endosome membrane; Peripheral membrane protein. |
Protein Families | SNF7 family |
Database References | HGNC: 24537 OMIM: 600795 KEGG: hsa:25978 STRING: 9606.ENSP00000263780 UniGene: PMID: 27621269 |