Recombinant Human Cell Surface Hyaluronidase (TMEM2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08070P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cell Surface Hyaluronidase (TMEM2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08070P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cell Surface Hyaluronidase (TMEM2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9UHN6 |
| Target Symbol | TMEM2 |
| Synonyms | KIAA1412; TMEM 2; tmem2; TMEM2_HUMAN; Transmembrane protein 2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS |
| Expression Range | 104-250aa |
| Protein Length | Partial |
| Mol. Weight | 21.5 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate. |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
| Protein Families | TMEM2 family |
| Database References | HGNC: 11869 OMIM: 605835 KEGG: hsa:23670 STRING: 9606.ENSP00000366243 UniGene: PMID: 27253403 |
