Recombinant Human Cell Division Cycle Protein 20 Homolog (CDC20) Protein (His&Myc)

Name: Recombinant Human Cell Division Cycle Protein 20 Homolog (CDC20) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01652P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cell Division Cycle Protein 20 Homolog (CDC20) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q12834
Target Symbol	CDC20
Synonyms	p55CDC
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
Expression Range	1-499aa
Protein Length	Full Length
Mol. Weight	62.2 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Subcellular Location	Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole.
Protein Families	WD repeat CDC20/Fizzy family
Database References	HGNC: 1723 OMIM: 603618 KEGG: hsa:991 STRING: 9606.ENSP00000308450 UniGene: PMID: 28112196 Cdc20 may be a promising molecular target for chemotherapy. PMID: 29901174 Long non-coding RNA SPRY4-IT1 promotes cell proliferation and invasion by regulation of Cdc20 in pancreatic cancer cells PMID: 29489909 Cdc20 functions as an important negative regulator of SMAR1 in higher grades of cancer PMID: 28617439 Data provide support for the recent structure-based models and functionally dissect three elements of Cdc20 inhibition: sequestration of Cdc20 in the core mitotic checkpoint complex, sufficient at low Cdc20 concentrations; inhibition of a second Cdc20 through the Mad3 C terminus, independent of Mad2 binding to this Cdc20 molecule; and occupancy of the APC/C with full MCC, where Mad3 and Apc15 are involved. PMID: 28366743 CDC20 gene, related to cell proliferation in protein complex A, might play momentous roles in the initiation and development of consecutive Trauma-Induced Sepsis. PMID: 29642183 A mitotic phosphorylation site on Cdc20, known to be a substrate of PP2A(B56), modulates APC/C(Cdc20) assembly. PMID: 28404789 c-Myc is a driver when combined with kRas/Akt3 oncogenic signals in gliomagenesis, whereas Cdc20 overexpression is a passenger PMID: 26993778 The ABBA-KEN-ABBA amino acid motif cassette holds the Mitotic Checkpoint Complex (MCC) onto the Anaphase-Promoting Complex-Cyclosome (APC/C) by binding the two Cdc20 molecules in the MCC-APC/C complex. PMID: 27939943 It discuses the roles of Cdc20 in SAC signalling and mitotic exit, describe how the integration of traditional approaches with emerging technologies has revealed new details of Cdc20 functions, comment about the potential of Cdc20 as a therapeutic target for the treatment of human malignancies. PMID: 28202332 Prostate cancer-derived SPOP mutants failed to interact with Cdc20 to promote its degradation. As a result, SPOP-deficient prostate cancer cells with elevated Cdc20 expression became resistant to a pharmacological Cdc20 inhibitor. PMID: 27780719 High CDC20 expression is associated with metastatic castration-resistant prostate cancer growth and reduces chemosensitivity . PMID: 27633058 These results provide novel insight into the mechanisms underlying the aberrant capability of NUP98 oncoproteins to interact with APC/C(Cdc20) and to interfere with its function. PMID: 27097363 In lung adenocarcinoma patients, overexpression of cell division cycle 20 was significantly associated with bigger primary tumor size, higher MKI67 level, higher DNA ploidy level, and poor prognosis. PMID: 28349831 CDC20 may have a role in carcinoma of the breast, colon, endometrium, and prostate PMID: 26245990 Overexpression of Cdc20 may serve as an independent predictor for biochemical recurrence in patients of clinically localized prostate cancer undergoing laparoscopic radical prostatectomy without neoadjuvant therapy. PMID: 26889981 Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1. PMID: 26626260 The presence of this segment correlates with SAC activity and efficient binding of CDC20 but not of MAD1 to kinetochores. PMID: 26148513 These results suggest CDC20 is a critical regulator of TIC proliferation and survival, linking two key TIC nodes-FOXM1 and p21CIP1/WAF1-elucidating a potential point for therapeutic intervention. PMID: 25938542 CDC20 is essential for the in vivo tumorigenicity of glioblastoma stem-like cells. CDC20 is prognostic of overall survival in Proneural subtype glioblastoma patients. PMID: 26074073 spindle checkpoint release further increases APC/C(Cdc20) catalytic activity PMID: 25673878 CDC20, MAD2 and Aurora-B protein expression are associated with chromosomal abnormalities and poor prognosis in patients with myelodysplastic syndromes. PMID: 25637637 Results show that increased expression of CDC20 was demonstrated to be associated with the development and progression of hepatocellular carcinoma. PMID: 25069850 The master cell cycle regulator Cdc20 regulates ciliary length and disassembly of the primary cilium. PMID: 25139956 the mitotic checkpoint complex (MCC) can inhibit a second CDC20 that has already bound and activated the APC/C; the MCC inhibits active APC/C and this is essential for the spindle assembly checkpoint PMID: 25383541 MAD2 and CDC20 overexpression was increased in high-grade squamous intraepithelial lesions and squamous cell carcinomas, suggesting their involvement in the initiation of cervical cancers. PMID: 25083970 excess E2F1 due to Rb inactivation recruits the complex of Cdc20 and the anaphase-promoting complex/cyclosome to deregulate the expression of UBCH10 PMID: 25368385 IR motif integrity is particularly important for stable binding to the APC/C. PMID: 24464857 CDC20 upregulation was associated with aggressive progression and poor prognosis in gastric cancer. PMID: 24551295 high Cdc20 and securin immunoexpression identified a patient subgroup with extremely short, on average 2.4 years, breast cancer survival and triple-negative breast cancer subtype. PMID: 24853182 Mad2, the kinetochore localization of Cdc20, is disrupted in Chk1 depleted cells. PMID: 24747134 These results reveal an important role for APC(Cdc20) in governing apoptosis, strengthening the rationale for developing specific Cdc20 inhibitors as effective anticancer agents. PMID: 24871945 CDC20 is increased in patients with colorectal cancer with poor prognosis PMID: 23758705 increased expression of CDC20 and MAD2 is related to poor prognosis of urothelial carcinoma of the human bladder PMID: 23995871 PHF8 is regulated by APC(cdc20) and plays an important role in the G2/M transition. PMID: 23979597 Geminin is a target of the spindle checkpoint and APC/C(Cdc20). PMID: 23775192 phosphorylation on CRY-box by Polo-like kinase-1 is required for Cdh1-dependent degradation of Cdc20 during somatic cell cycle PMID: 23643811 High CDC20 expression is associated with cervical cancer. PMID: 23405241 Nek2A binds with high affinity to apo-APC/C and is degraded by the pool of Cdc20 that avoids inhibition by the spindle assembly checkpoint. PMID: 23288039 The crystal structures of human Cdc20 alone or bound to a BubR1 KEN box, is reported. PMID: 23091007 APC/C(Cdc20) or APC/C(Cdh1) complexes regulate RAP80 stability during mitosis to the G(1) phase, and these events are critical for a novel function of RAP80 in mitotic progression. PMID: 22426463 Data identify Cdc20, USP44, and Wee1 as relevant Fcp1 targets. PMID: 22692537 Aberrant CDC20 expression may play an important role in pancreatic ductal adenocarcinoma tumorigenesis and progression and may thus be useful as a marker of disease progression and prognosis and as a therapeutic target. PMID: 22475564 CDC20-mediated degradation of conductin regulates Wnt/beta-catenin signalling for maximal activity during G1/S. PMID: 22322943 The binding of p31(comet) to Mad2 in the mitotic checkpoint complex may trigger a conformational change in Cdc20 that facilitates its phosphorylation by Cdk, and that the latter process may promote its dissociation from BubR1. PMID: 22566641 both p31(comet) and ubiquitination of Cdc20 are critical mechanisms of checkpoint inactivation. They act redundantly to promote Mad2 dissociation from Cdc20. PMID: 21937719 These findings expand our knowledge of both Sp100 and Cdc20 as well as their role in ubiquitination. PMID: 22086178 Anaphase promoting complex subunit 15(APC15) mediates the constant turnover of CDC20 and mitotic checkpoint protein complexes, allowing the spindle checkpoint assembly to respond to the attachment state of kinetochores. PMID: 21926987 Spindle assembly checkpoint protein Cdc20 transcriptionally activates expression of ubiquitin carrier protein UbcH10. PMID: 21454660 These data suggest that APC/C(Cdc20) specifically targets E2F1 for degradation in early mitosis and reveal a novel mechanism for limiting free E2F1 levels in cells, failure of which may compromise cell survival and/or homeostasis. PMID: 20948288

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.