Recombinant Human CD64 Protein
Beta LifeScience
SKU/CAT #: BLA-11052P
Recombinant Human CD64 Protein
Beta LifeScience
SKU/CAT #: BLA-11052P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P12314 |
| Synonym | CD 64 CD64 CD64 antigen CD64A CD64b CD64c Fc fragment of IgG high affinity Ia receptor Fc fragment of IgG high affinity Ib receptor Fc fragment of IgG high affinity Ic receptor Fc fragment of IgG, high affinity Ia, receptor (CD64) Fc fragment of IgG, high affinity Ia, receptor for Fc fragment of IgG, high affinity Ia, receptor for (CD64) Fc fragment of IgG, high affinity Ib, receptor (CD64) Fc fragment of IgG, high affinity Ib, receptor for Fc fragment of IgG, high affinity Ic, receptor (CD64) Fc fragment of IgG, high affinity Ic, receptor (CD64), pseudogene Fc fragment of IgG, high affinity Ic, receptor for Fc gamma receptor Fc gamma receptor I Fc gamma receptor I A1 Fc gamma receptor I B2 Fc gamma RI Fc gamma RIA Fc gamma RIB Fc of IgG high affinity Ia receptor Fc-gamma RI Fc-gamma RIA Fc-gamma RIC FCG 1 FCG1 FcgammaRI FcgammaRIa FCGR 1 FCGR1 FCGR1_HUMAN FCGR1A FCGR1B FCGR1C FcRI FcRIB FCRIC FLJ18345 HFcgammaRIB High affinity immunoglobulin gamma Fc receptor I High affinity immunoglobulin gamma Fc receptor IB IGFR 1 IGFR1 IGFRB IGFRC IgG Fc receptor I IgG Fc receptor IB IgG Fc receptor IC Immunoglobulin G Fc receptor I Immunoglobulin G Fc receptor IB Immunoglobulin G Fc receptor IC MGC137713 |
| Description | Recombinant Human CD64 Protein was expressed in Wheat germ. It is a Full length protein |
| Source | Wheat germ |
| AA Sequence | MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPG SSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEI HRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWN SNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTS PLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTA RREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEE LKCQEQKEEQLQEGVHRKEPQGAT |
| Molecular Weight | 67 kDa including tags |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
