Recombinant Human Cd59 Glycoprotein (CD59) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03370P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd59 Glycoprotein (CD59) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03370P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cd59 Glycoprotein (CD59) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P13987 |
Target Symbol | CD59 |
Synonyms | 16.3A5; 1F5 ; 1F5 antigen; 20 kDa homologous restriction factor; CD 59; CD_antigen=CD59; CD59; CD59 antigen; CD59 antigen complement regulatory protein ; CD59 antigen p18 20 ; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5; EJ16; EJ30; EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule complement regulatory protein; CD59_HUMAN; Cd59a; Complement regulatory protein; EJ16; EJ30; EL32; FLJ38134; FLJ92039; G344; HRF 20; HRF-20; HRF20; Human leukocyte antigen MIC11 ; Ly 6 like protein ; Lymphocytic antigen CD59/MEM43 ; MAC inhibitory protein; MAC IP; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen; Membrane attack complex (MAC) inhibition factor ; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18 20; Protectin; Surface antigen recognized by monoclonal 16.3A5; T cell activating protein |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
Expression Range | 26-102aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.0kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Soluble form found in a number of tissues. |
Database References | HGNC: 1689 OMIM: 107271 KEGG: hsa:966 STRING: 9606.ENSP00000340210 UniGene: PMID: 29693588 |