Recombinant Human CD40 Protein (C-hFc-Avi)
Beta LifeScience
SKU/CAT #: BLC-11418P
Greater than 90% as determined by SDS-PAGE.Greater than 95% as determined by SEC-HPLC.
Recombinant Human CD40 Protein (C-hFc-Avi)
Beta LifeScience
SKU/CAT #: BLC-11418P
Regular price
$94900
$949.00
Sale price$24000
$240.00Save $709
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Purity | Greater than 90% as determined by SDS-PAGE.Greater than 95% as determined by SEC-HPLC. |
| Uniprotkb | P25942 |
| Target Symbol | CD40 |
| Species | Human |
| Expression System | Baculovirus |
| Tag | C-terminal hFc-Avi-tagged |
| Target Protein Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Expression Range | 21-193aa |
| Protein Length | Partial |
| Mol. Weight | 46.9 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Target Function | Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. |
| Subcellular Location | [Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted. |
| Database References |
HGNC: 11919 OMIM: 109535 KEGG: hsa:958 STRING: 9606.ENSP00000361359 UniGene: Hs.472860 |
| Tissue Specificity | B-cells and in primary carcinomas. |

