Recombinant Human Cd320 Antigen (CD320) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08329P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd320 Antigen (CD320) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08329P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cd320 Antigen (CD320) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NPF0 |
| Target Symbol | CD320 |
| Synonyms | 8D6; 8D6 antigen; 8D6A; CD320; CD320 antigen; CD320_HUMAN; FDC-signaling molecule 8D6; FDC-SM-8D6; TCblR; Transcobalamin receptor |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV |
| Expression Range | 36-231aa |
| Protein Length | Partial |
| Mol. Weight | 47.1kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 16692 OMIM: 606475 KEGG: hsa:51293 STRING: 9606.ENSP00000301458 UniGene: PMID: 29537328 |
