Recombinant Human CD3 Protein
Beta LifeScience
SKU/CAT #: BLA-10941P
Recombinant Human CD3 Protein
Beta LifeScience
SKU/CAT #: BLA-10941P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P07766P09693 |
| Synonym | 4930549J05Rik A430104F18Rik AW552088 Cd247 CD247 antigen CD247 antigen, zeta subunit CD247 molecule CD3 CD3 antigen, delta subunit CD3 delta CD3 epsilon CD3 eta CD3 gamma CD3 molecule delta polypeptide CD3 molecule, epsilon polypeptide CD3 molecule, gamma polypeptide CD3 zeta CD3-DELTA CD3d CD3D antigen delta polypeptide CD3d antigen, delta polypeptide (TiT3 complex) CD3d molecule delta CD3d molecule delta CD3 TCR complex CD3d molecule, delta (CD3-TCR complex) CD3D_HUMAN CD3E CD3e antigen CD3E antigen epsilon polypeptide CD3e antigen, epsilon polypeptide (TiT3 complex) CD3e molecule epsilon CD3e molecule epsilon CD3 TCR complex CD3e molecule, epsilon (CD3-TCR complex) CD3epsilon CD3G CD3g antigen CD3G antigen gamma polypeptide CD3g antigen, gamma polypeptide (TiT3 complex) CD3g molecule gamma CD3g molecule gamma CD3 TCR complex CD3g molecule, gamma (CD3-TCR complex) CD3H CD3Q CD3Z CD3zeta Ctg3 FLJ17620 FLJ17664 FLJ18683 FLJ79544 FLJ94613 IMD19 Leu-4 MGC138597 OKT3, delta chain OTTHUMP00000032544 T cell receptor T cell receptor T3 delta chain T cell receptor T3 gamma chain T cell receptor T3 zeta chain T cell receptor zeta chain T cell surface antigen T3/Leu 4 epsilon chain T cell surface glycoprotein CD3 T cell surface glycoprotein CD3 delta chain T cell surface glycoprotein CD3 epsilon chain T cell surface glycoprotein CD3 gamma chain T cell surface glycoprotein CD3 zeta chain T-cell antigen receptor complex, delta subunit of T3 T-cell antigen receptor complex, epsilon subunit of T3 T-cell antigen receptor complex, gamma subunit of T3 T-cell antigen receptor complex, zeta subunit of CD3 T-cell receptor T3 delta chain T-cell receptor T3 gamma chain T-cell surface antigen T3/Leu-4 epsilon chain T-cell surface glycoprotein CD3 delta chain T-cell surface glycoprotein CD3 epsilon chain T-cell surface glycoprotein CD3 gamma chain T3 T3d T3e T3g T3z TCRE TCRk Tcrz TCRzeta |
| Description | Recombinant Human CD3 Protein was expressed in HEK293. It is a Protein fragment |
| Source | HEK293 |
| AA Sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDD KNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENC MEMD |
| Molecular Weight | 39 kDa including tags |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized OKT3 MAb at 10μg/mL (100μL/well) can bind this protein with a linear range of 0.3-5μg/mL. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
