Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05578P
Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05578P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml. |
| Uniprotkb | Q5ZPR3 |
| Target Symbol | CD276 |
| Synonyms | 4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-FC-Myc |
| Target Protein Sequence | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG |
| Expression Range | 29-245aa |
| Protein Length | Partial |
| Mol. Weight | 53.4 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Earlier studies found that B7H3 (also known as B7H3) promotes the activation of T cells. Chapoval et al. confirmed that in the presence of anti-CD3 antibodies, B7H3 can promote the proliferation of CD4 and CD8+ T cells and selectively promote the secretion of IFN-γ. And B7H3 transfection into tumor cells can enhance the killing ability of CTL. Further research found that only TLT-2 transgenic cells could bind to mouse B7H3 with high affinity, and TLT-2 was determined to be the receptor molecule of B7H3. Moreover, Hashiguchi et al. confirmed that the B7H3-TLT-2 pathway enhanced T cell activation. However, Leitner et al. did not find the specific binding of B7H3 to TLT-2 by flow cytometry, therefore, the exact receptor molecule of B7H3 is still unclear. On the other hand, studies have found that B7H3 can also suppress T-cell immune responses. Some studies have shown that B7H3 can inhibit human and mouse T cells by activating or inhibiting NFTA (nuclear factor for activated T cells), NF-KB (nuclear factor kB) and AP-1 (activator protein-1) pathways. activation. In addition, results have demonstrated that B7H3 may inhibit T cell immune responses by inhibiting the activity of Thl. The study of Leiner et al. also found that B7H3 can down-regulate the secretion of IL-2 in T cells to inhibit the activity of T cells. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Database References | HGNC: 19137 OMIM: 605715 KEGG: hsa:80381 STRING: 9606.ENSP00000320084 UniGene: PMID: 30486739 |
