Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active

Name: Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active
Brand: Beta LifeScience
SKU: BLC-05578P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC 50 of human CD276 protein is 1.961-2.243 ng/ml. Biological Activity Assay

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cd276 Antigen (CD276) Protein (Fc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.
Uniprotkb	Q5ZPR3
Target Symbol	CD276
Synonyms	4Ig B7 H3; 4Ig-B7-H3; AU016588; B7 H3; B7 homolog 3; B7-H3; B7H3; B7RP-2; CD_antigen=CD276; CD276; CD276 antigen; CD276 molecule; CD276_HUMAN; Costimulatory molecule; Flags: Precursor; PSEC0249; UNQ309/PRO352
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-FC-Myc
Target Protein Sequence	LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
Expression Range	29-245aa
Protein Length	Partial
Mol. Weight	53.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Earlier studies found that B7H3 (also known as B7H3) promotes the activation of T cells. Chapoval et al. confirmed that in the presence of anti-CD3 antibodies, B7H3 can promote the proliferation of CD4 and CD8+ T cells and selectively promote the secretion of IFN-γ. And B7H3 transfection into tumor cells can enhance the killing ability of CTL. Further research found that only TLT-2 transgenic cells could bind to mouse B7H3 with high affinity, and TLT-2 was determined to be the receptor molecule of B7H3. Moreover, Hashiguchi et al. confirmed that the B7H3-TLT-2 pathway enhanced T cell activation. However, Leitner et al. did not find the specific binding of B7H3 to TLT-2 by flow cytometry, therefore, the exact receptor molecule of B7H3 is still unclear. On the other hand, studies have found that B7H3 can also suppress T-cell immune responses. Some studies have shown that B7H3 can inhibit human and mouse T cells by activating or inhibiting NFTA (nuclear factor for activated T cells), NF-KB (nuclear factor kB) and AP-1 (activator protein-1) pathways. activation. In addition, results have demonstrated that B7H3 may inhibit T cell immune responses by inhibiting the activity of Thl. The study of Leiner et al. also found that B7H3 can down-regulate the secretion of IL-2 in T cells to inhibit the activity of T cells.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, BTN/MOG family
Database References	HGNC: 19137 OMIM: 605715 KEGG: hsa:80381 STRING: 9606.ENSP00000320084 UniGene: PMID: 30486739 characterization of the expression pattern and biological function of B7-H3 in brain gliomas; B7-H3 expression is regulated by multiple mechanisms and is potentially involved in the T-cell receptor signaling pathway; higher B7-H3 expression indicates a worse prognosis for glioma patients PMID: 30027617 High expression level of B7H3 in muscleinvasive bladder cancer (MIBC) tissues is associated with a poor clinico-pathological status and poor prognosis, and promotes the development of MIBC in vitro and in vivo. PMID: 30132557 Tumor B7-H3 expression was significantly higher in immunocompetent vs. immunosuppressed patients, largely driven by very low expression in HIV+ patients. PMID: 29484464 Colorectal cancer (CRC) patients expressing both high B7-H3 and high B3GALT4 contributed to a significant decrease in overall survival. The expression of B3GALT4 in CRC is positively correlated with B7-H3 expression in vitro. B7-H3/B3GLAT4 may be used as dual prognostic biomarkers for CRC. PMID: 30131660 this study shows reduced sB7-H3 expression in the peripheral blood of systemic lupus erythematosus patients PMID: 29423417 High B7-H3 expression is associated with cervical cancer invasiveness. PMID: 28627681 IDH1 and B7H3 cannot be used as independent prognostic factors, co-expression of IDH1 and B7H3 significantly correlated with the prognosis of CRC patients and may serve as a combined predictive marker. Thus, the correlation between IDH1 and B7H3 has been proven in vivo and in vitro. PMID: 29871819 Our findings revealed that B7-H3 affect ovarian cancer progression through the Jak2/Stat3 pathway, indicating that B7-H3 has the potential to be a useful prognostic marker. PMID: 28765941 metastatic melanoma cells with knockdown expression of B7-H3 showed modest decrease in proliferation and glycolytic capacity. PMID: 28513992 results suggest that B7-H3 may be a valuable biomarker in determining tumor progression and prognosis of intrahepatic cholangiocarcinoma PMID: 29696716 these results demonstrate that sB7-H3 promotes invasion and metastasis through the TLR4/NF-kappaB pathway in pancreatic carcinoma PMID: 27273624 Inhibition of the B7-H3 immune checkpoint limits tumor growth by enhancing cytotoxic lymphocyte function PMID: 28685773 Higher B7-H3 expression correlates with Gleason grade, prostate cancer stage and poor oncologic outcomes in prostatectomy cohorts. B7-H3 expression appears to be related to androgen signaling as well as the immune reactome. PMID: 27801901 Review/Meta-analysis: High B7-H3 expression was a significant indicator of lymph node metastasis and advanced TNM stage in non-small cell lung cancer. PMID: 27835582 B7-H3 promotes epithelial mesenchymal transformation in colorectal cancer cells by activating the PI3K-Akt pathway and upregulating the expression of Smad1. PMID: 27145365 Plasma B7-H3 levels were decreased significantly in children subjected to pediatric general and cardiac surgery, which is closely associated with the severity of surgical stress. The negative correlation of plasma B7-H3 levels at day 1 and day 3 after surgery with surgical stress scoring implicates that the plasma B7-H3 level might be a useful biomarker for monitoring stress intensity during pediatric surgery. PMID: 27459969 B7-H3 promotes the oxaliplatin resistance in colorectal cancer cells upregulating the expression of XRCC1 via PI3K-AKT pathway. PMID: 28676400 Children with Mycoplasma pneumoniae pneumonia had significantly higher levels of sB7-H3 and IL-36 compared to control subjects. PMID: 27188891 CD276 is broadly expressed by tumor cells and tumor vasculature but Is dispensable for tumor growth. PMID: 28399408 B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer PMID: 27939887 We found that B7-H3 promoted the Warburg effect, evidenced by increased glucose uptake and lactate production in B7-H3-expressing cells. B7-H3 also increased the protein levels of HIF1alpha and its downstream targets, LDHA and PDK1, key enzymes in the glycolytic pathway PMID: 27197253 Upregulated sB7-H3 expression in MPEs is correlated with TNM stage of NSCLC and may serve as a potential biomarker for NSCLC-derived MPEs PMID: 27071700 High expression of B7-H3 is associated with Colorectal cancer. PMID: 26787540 Elevated B7-H3 expression is significantly associated with poor survival in cancer patients. (Meta-analysis) PMID: 27626927 The results provide novel insights into the function of B7-H3 in cancer, and suggest that targeting of B7-H3 may be a novel alternative to improve current anticancer therapies. PMID: 26771843 Suggesting that B7-H3 and Tregs may act cooperatively in tumor immune evasion, leading to poor outcomes for NSCLC patients. PMID: 26823710 B7-H3 is one of the most strongly expressed B7-family molecules in AML and merits further investigation. PMID: 26376842 findings demonstrate that activation-induced B7-H3 expression on synovial monocytes has the potential to inhibit Th1-mediated immune responses and immunomodulatory roles affecting RA pathogenesis. PMID: 26702052 B7H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer PMID: 26151358 B7-H1 and B7-H3 are independent predictors of poorer survival in patients with non-small cell lung cancer. PMID: 25609202 B7-H3 may play an important role in asthma exacerbation and was a useful clinical biomarker to evaluate asthma exacerbation. PMID: 26108069 found that the N-glycans of B7-H3 from Ca9-22 oral cancer cells contain the terminal alpha-galactose and are more diverse with higher fucosylation and better interaction with DC-SIGN and Langerin on immune cells than that from normal cells PMID: 26438868 Study shows that B7-H3 promotes mantle cell lymphoma progression and its knockdown significantly enhances the chemosensitivity. PMID: 25872657 These results demonstrated that B7-H3 expression in acute leukemia predicts an unfavorable outcome. PMID: 25130683 Our results indicate that B7-H3 expression in cervical invasive squamous cell carcinoma may play an important role in overcoming CD8(+) T-cell immunoregulation to acquire aggressive growth. PMID: 25675190 Data shows that B7-H3 is aberrantly expressed in gastric cancer. In addition to modulating tumor immunity, B7-H3 may have a novel role in regulating SGC-7901 cell metastasis. PMID: 25120098 Overexpression of B7-H3 in CD14+ monocytes is associated with renal cell carcinoma progression.B7-H3 might play an important role in angiogenesis of renal cell carcinoma mediated by CD14(+) monocytes. PMID: 25416051 Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling. PMID: 26149216 IL-2/IL-2R and B7-H3 pathways may be involved in the progression of clear cell renal cell carcinoma PMID: 25089268 The overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer cell lines by upregulating the Jak2-STAT3 signaling pathway. PMID: 25684945 B7-H3 was significantly up-regulated on monocytes in rheumatoid arthritis patients, while soluble B7-H3 in serum was decreased. A polymorphism variant, B7-H3-T-A-C-T, was shown to be associated with the incidence of RA and the decreased release of sB7-H3. PMID: 25931383 B7-H3-mediated STAT3 signaling pathway is an important mechanism for inducing M2-type polarization of tumor associated macrophages. PMID: 25370943 The study confirms the overexpression of B7-H3 in colorectal cancer and shows the main localization of the protein in cytoplasm and cell membrane. PMID: 25139714 High level of serum B7-H3 in patients with Hepatocellular Carcinoma is caused by the increased expression of a newly discovered spliced soluble B7-H3 isoform in carcinoma and peritumor tissues. PMID: 24194851 Data indicate that six sites of co-stimulatory molecule B7-H3 gene have single nucleotide polymorphisms variations and five sites are related to the pathogenesis of rheumatoid arthritis (RA). PMID: 25200161 Study shows that CD276 can be used to discriminate ECs from malignant tissue from ECs from normal tissue. In addition, CD276(+) CEC do occur in higher frequencies in patients with advanced cancer. PMID: 24892449 Data indicate that the expression of membrane B7-H3 (mB7-H3) in peri-tumor normal tissues was higher than that in tumor tissues, and it can serve as an assistant diagnostic marker for hepatitis B virus-associated hepatocellular carcinoma (HBV-HCC). PMID: 25001942 B7H3 and ATP1B3 are overexpressed in tumor endothelial cells, favoring an angiogenic phenotype. PMID: 24236063 Thus, B7-H3 may have a critical role in primary hepatocellular carcinoma and it may enhance tumor escape from the immune surveillance of CD8(+) T cells. PMID: 24787022

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.