Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active
Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. |
| Uniprotkb | Q15762 |
| Target Symbol | CD226 |
| Synonyms | (DNAM-1)(DNAM1) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc-Myc |
| Target Protein Sequence | EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN |
| Expression Range | 19-247aa |
| Protein Length | Partial |
| Mol. Weight | 56.1 |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 16961 OMIM: 605397 KEGG: hsa:10666 STRING: 9606.ENSP00000280200 UniGene: PMID: 30255106 |

