Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active

Beta LifeScience SKU/CAT #: BLC-05866P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Activity FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. Biological Activity Assay
Activity FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. Biological Activity Assay

Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active

Beta LifeScience SKU/CAT #: BLC-05866P
Regular price $428.00 Sale price $240.00Save $188
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Cd226 Antigen (CD226) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.
Uniprotkb Q15762
Target Symbol CD226
Synonyms (DNAM-1)(DNAM1)
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-hFc-Myc
Target Protein Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Expression Range 19-247aa
Protein Length Partial
Mol. Weight 56.1
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Database References

HGNC: 16961

OMIM: 605397

KEGG: hsa:10666

STRING: 9606.ENSP00000280200

UniGene: PMID: 30255106

  • T allele and TT genotype of the CD226 rs763361 polymorphism is associated with susceptibility to type 1 diabetes and with a lower age of disease onset among Egyptian children PMID: 30145014
  • These findings highlight the importance of the TIGIT/CD226/PVR axis as an immune checkpoint barrier that could hinder future "cure" strategies requiring potent HIV-specific CD8(+) T cells PMID: 28084312
  • Sole engagement of NKG2D, 2B4 or DNAM-1 is insufficient for NF-kappaB activation. PMID: 27221592
  • The Serum level of CD226 and not CD226 genotypes could be considered as an independent risk factor for the prediction of RA within healthy individuals and also for RA disease activity. PMID: 29319370
  • Natural killer cells and cytotoxic T cells express both TIGIT and DNAM-1 receptors, and in certain cases their effector functions are dictated by TIGIT or DNAM-1 signaling. Agonist and antagonist antibodies targeting either TIGIT or DNAM-1 present many therapeutic options for diseases spanning from cancer to auto-immunity. (Review) PMID: 28035916
  • Results indicate that low-grade inflammation coupled with elevated blood glucose increases CD226 expression, resulting in decreased endothelial cell glucose uptake in T2DM. PMID: 26910838
  • Results show that CD226 expression was down-regulated in human hepatocellular carcinoma (HCC) cells. MiR-892a directly targeted CD226 promoting HCC cells proliferation and invasion. PMID: 27883251
  • cumulative incidences of acute graft-versus-host disease in patients with high maximal serum levels of sDNAM-1 (>/=30 pM) in the 7 days before allogeneic hematopoietic stem cell transplantation were significantly higher than those in patients with low maximal serum levels of sDNAM-1 in the same period. Our data suggest sDNAM-1 is potentially a unique candidate as a predictive biomarker for the development of acute GVHD. PMID: 27257974
  • Our results support an important association of rs4810485 in CD40 gene and rs763361 in CD226 gene polymorphism, combined effect of rs4810485 and rs763361 with increased risk of systemic lupus erythematosus. PMID: 27722794
  • our results support and explain the mechanism behind the recently reported finding that in EOC, NK-cell recognition and killing of tumor cells was mainly dependent on DNAM-1 signaling while the contribution of the NKG2D receptor-ligand pathway was complementary and uncertain. PMID: 26563374
  • CD226 rs763361 polymorphism was significantly associated with susceptibility to T1D. PMID: 26634488
  • Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells. PMID: 25991472
  • we propose that expression of DNAM-1 on inflammatory monocytes are evolutionally conserved and act as an adhesion molecule on blood inflammatory monocytes. PMID: 26675069
  • DNAM-1 ligands CD112 and CD155 as well as the NKG2D ligands MICA and MICB were expressed on the hiPSC lines PMID: 25950680
  • The CD226 gene has been identified as novel association with JIA, and a SNP near CD28 as a suggestive association. PMID: 25057181
  • Effector and regulatory CD4+ memory T cells of healthy individuals carrying the predisposing CD226 variant showed, in comparison to carriers of the protective variant, reduced surface expression of CD226 and impaired induction of CD226 after stimulation. PMID: 26359290
  • The present study provides evidence that regulation of the PVR/CD155 DNAM-1 ligand expression by nitric oxide may represent an additional immune-mediated mechanism and supports the anti-myeloma activity of nitric oxide donors. PMID: 25609078
  • our data reveal the existence of a functional program of NK cell maturation marked by DNAM-1 expression. PMID: 25818301
  • genetic polymorphism is associated with rheumatoid arthritis, meta-analysis PMID: 25645050
  • upregulated CD226 expression on CD8(+) T cells reflects disease severity and is involved in Systemic sclerosis pathogenesis via the production of various cytokines, including profibrotic IL-13 and endothelial cell injury PMID: 26109642
  • NKG2D and DNAM-1 ligand upregulation might sensitize B cells undergoing lytic Epstein-Barr virus replication to NK cell recognition. (Review) PMID: 25597312
  • Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation. PMID: 25994968
  • Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells. PMID: 25684021
  • NKG2D and DNAM-1 receptor-ligand interactions were essential in cytolysis by resting NK cells, as simultaneous blocking of both pathways resulted in almost complete abrogation of the cytotoxicity. PMID: 25854581
  • the coordinated expression of LFA-1 and DNAM-1 is a central component of NK cell education and provides a potential mechanism for controlling cytotoxicity by functionally mature NK cells. PMID: 25825444
  • Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients. PMID: 24769842
  • CD112 downregulation resulted in a reduced ability of DNAM-1 to bind to the surface of both virus-infected and gD-transfected cells. PMID: 25352670
  • These findings indicated that functional polymorphism rs727088A>G in CD226 might modify the susceptibility for the development of Gastric cancer. PMID: 25510399
  • Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms. PMID: 24882570
  • Findings suggest that TIGIT is a key checkpoint inhibitor of chronic antiviral and antitumor responses through impairing CD226 function when disrupting its homodimerization. PMID: 25465800
  • UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells. PMID: 25209846
  • rs763361 variant of CD226 gene (TT genotype) is associated with susceptibility to type 1 diabetes, greater frequency of GAD65 autoantibody, and with the degree of aggressiveness of the disease in T1D patients from Brazil PMID: 24891767
  • Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts. PMID: 24673109
  • CD226 rs763361, but not rs727088, gene polymorphism increased the risk of rheumatoid arthritis in a sample of the Iranian population. PMID: 23999715
  • these results show that CD226 functions in immune synapse formation via its first extracellular domain. PMID: 24451371
  • XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells. PMID: 24496997
  • The CD226/CD155 interaction regulates the proinflammatory (Th1/Th17)/anti-inflammatory (Th2) balance in humans. PMID: 23980210
  • While prior studies have found CD226 polymorphisms to be significantly associated with inflammatory demyelinating diseases, our results indicate the CD226 polymorphisms to be not associated with the diseases in Korean population. PMID: 23922043
  • Overexpression of DNAM-1 was detected in the skin of patients with SSc (systemic sclerosis) PMID: 23161903
  • CD226 Gly307Ser (rs763361) is significantly associated with the risk of multiple autoimmune diseases. PMID: 23073294
  • A CD226 three-variant haplotype is related with genetic predisposition to systemic sclerosis-related pulmonary fibrosis. PMID: 22531499
  • The G allele and GG genotype of rs727088 polymorphism in CD226 gene contributes to increased Cervical Squamous Cell Carcinoma susceptibility in a Han Chinese population. PMID: 23262348
  • This demonstrates the CD226 rs763361 polymorphism confers susceptibility to autoimmune disease in Europeans, South Americans and Asians PMID: 22941566
  • Demonstrate a genetic association between the CD226 gene and rheumatoid arthritis in a Chinese Han population with a potentially greater genetic effect than in the European population. PMID: 21286723
  • CD226 gene polymorphisms may not be associated with rheumatoid arthritis susceptibility. PMID: 22302395
  • CD226 polymorphisms, rs727088, rs34794968 and rs763361 were not involved in giant cell arteritis susceptibility in the Spanish population. PMID: 22512842
  • A soluble nectin-2 immunoglobulin-like V-set domain (nectin-2v) has been successfully prepared and demonstrates binding to both soluble ectodomain and cell surface-expressed full-length DNAX accessory molecule (DNAM)-1. PMID: 22547693
  • TIGIT can inhibit T cell functions by competing with CD226 and can also directly inhibit T cells in a T cell-intrinsic manner. PMID: 22427644
  • Data indicate that NK cells from acute myeloid leukemia (AML) patients younger than 65 years have a reduced expression of DNAM-1 compared with age-matched controls. PMID: 21383766
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed