Recombinant Human Cd177 Antigen (CD177) Protein (His-GST)

Name: Recombinant Human Cd177 Antigen (CD177) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-01654P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cd177 Antigen (CD177) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q8N6Q3
Target Symbol	CD177
Synonyms	Human neutrophil alloantigen 2a;HNA-2a;NB1 glycoprotein;NB1 GP;Polycythemia rubra vera protein 1;PRV-1;CD177
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
Expression Range	22-321aa
Protein Length	Partial
Mol. Weight	63.6 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	In association with beta-2 integrin heterodimer ITGAM/CD11b and ITGB2/CD18, mediates activation of TNF-alpha primed neutrophils including degranulation and superoxide production. In addition, by preventing beta-2 integrin internalization and attenuating chemokine signaling favors adhesion over migration. Heterophilic interaction with PECAM1 on endothelial cells plays a role in neutrophil transendothelial migration in vitro. However, appears to be dispensable for neutrophil recruitment caused by bacterial infection in vivo. Acts as a receptor for the mature form of protease PRTN3 allowing its display at the cell surface of neutrophils. By displaying PRTN3 at the neutrophil cell surface, may play a role in enhancing endothelial cell junctional integrity and thus vascular integrity during neutrophil diapedesis.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft; Lipid-anchor, GPI-like-anchor. Secreted. Cytoplasmic granule membrane. Cell projection, lamellipodium.
Database References	HGNC: 30072 OMIM: 162860 KEGG: hsa:57126 STRING: 9606.ENSP00000367248 UniGene: PMID: 28240246 our results have highlighted for the first time an up-regulated transcriptomics and phenotypic expression of neutrophil CD177 in septic shock patients compared to healthy volunteers. PMID: 27568821 CD177 signals in a beta2 integrin-dependent manner to orchestrate a set of activation-mediated mechanisms that impair human neutrophil migration. PMID: 28807980 Data show that CD177 protein is monoallelically expressed in neutrophils and neutrophil-differentiated hematopoietic stem cells (HSCs). PMID: 28559244 Abundance of CD177hi neutrophils correlates with homozygosity for CD177 reference allele, while heterozygosity for ectopic CD177P1 gene conversion correlates with increased CD177neg neutrophils, in which both CD177P1 partially incorporated allele and paired intact CD177 allele are transcribed PMID: 27227454 Data indicate that high percentage of CD177 antigen-positive neutrophils undergo dynamic change during sepsis. PMID: 26829180 the CD177 SNP is the primary genetic determinant for HNA-2 deficiency and expression variations. The mechanistic delineation of HNA-2 genetics will enable the development of genetic tests for diagnosis and prognosis of HNA-2-related human diseases. PMID: 26024230 This is the first report showing a prognostic correlation between CD177 expression and solid tumor behavior. PMID: 23899160 Skewed low neutrophil CD177(%) is highly associated with clonal myeloid disorders, particularly myelodysplasia, and may be useful for detecting clonal myeloid disorders. PMID: 24124144 CD177/PECAM-1 adhesive interaction, while contributing to neutrophil-endothelial cell interaction in neutrophil transendothelial migration, does not contribute to or is redundant in platelet-neutrophil interactions PMID: 22690867 PRV1 overexpression is associated with Essential Thrombocythemia and Myelofibrosis. PMID: 22300941 NB1-proteinase 3 interactions may play a role in aiding neutrophil transmigration. PMID: 22266279 pivotal role of the NB1-Mac-1 receptor interaction for PR3-ANCA-mediated neutrophil activation PMID: 21193407 The increased membrane expression of PR3 found in ANCA-associated systemic vasculitis is not linked directly to circulating PR3 or PR3 gene transcription, but is dependent upon CD177 expression and correlated with the transcription of the CD177 gene. PMID: 20491791 heterophilic PECAM-1/CD177 interactions affect the phosphorylation state of PECAM-1 and endothelial cell junctional integrity in such a way as to facilitate neutrophil transmigration in a previously unrecognized allele-specific manner. PMID: 20194726 Testins for PRV-1 expression is useful in the diagnosis of essential thrombocythaemia, but not in the diagnosis of polycythaemia vera. PMID: 19999391 biochemical characterization; overexpressed in polycythemia rubra vera PMID: 12239154 overexpression of PRV-1 to discrimitate essential thrombocythemia and polycythemia vera from secondary thrombocytosis and secondary erythrocytosis PMID: 12377969 No evidence for a PRV-1 gene rearrangement was found in metaphase or interphase cells in polycythemia vera and thus, overexpression of PRV-1 in granulocytes in PV is related to mechanisms that do not involve structural genetic changes. PMID: 12591276 review of gene structure, gene expression, polymorphisms, and relevance to diseases PMID: 12617169 Comparing cDNA sequences of donors with a large (> 60%) and those with a small (< 40%) NB1 GP-expressing subpopulation, we found 6 polymorphisms. 3 were significantly associated with a small NB1 GP-expressing subpopulation. PMID: 12623849 association between elevated PRV-1 mRNA expression and low plasma erythropoietin concentration in essential thrombocythaemia and the effect of platelet lowering treatment on the ratio PMID: 12756017 This review summarizes and evaluates recent advances in our understanding of molecular aberrations in PV. PMID: 12901344 PRV-1 and NB1 are alleles of polymorphic gene CD177. The most common single nucleotide polymorphisms in bp 42 predicted an amino acid change that may have an effect on protein expression. PMID: 14692971 neutrophil PRV-1 up-regulation is a characteristic feature of polycythemia vera that may not be affected by fibrotic transformation PMID: 14701686 Change in the number of neutrophils and monocytes is related to HNA-2a expression during pregnancy and postpartum. Both decrease postpartum and in threatened premature labor. PMID: 15043575 The PRV1 protein altered expression provide an opportunity to diagnose and identify subpopulations of MPD patients. PMID: 15572213 PRV-1 overexpression is associated with a significantly increased risk of thrombosis, whereas decreased c-Mpl expression is not PMID: 15951300 Presence of the Janus kinase 2 V617F mutation was very highly correlated with polycythemia rubra vera 1 overexpression PMID: 15985544 RT-PCR is the most rapid, reliable, and feasible method for the detection of PRV-1 overexpression in highly purified peripheral blood granulocytes in polycythemia rubra vera and essential thrombocythemia. PMID: 16502591 FISH study showed no cytogenetic abnormalities in any of the analyzed cases. PMID: 16682284 Proteinase 3 and NB1 coimmunoprecipitated from and colocalized on the neutrophil plasma membrane. PMID: 17244676 neutrophil-specific CD177 is a heterophilic binding partner of PECAM-1 PMID: 17580308 DNA methylation regulates PRV-1 expression under physiologic and pathologic conditions PMID: 17976520 a novel function for Prv-1 as a signaling molecule in cytokine signaling cascades and may lead to a greater understanding of the mechanism of overexpression of Prv-1 in myeloproliferative disorders. PMID: 17980909 The NB1-bound PR3 was active and was cleared from the surface by alpha-1-protease inhibitor PMID: 18854317 elevated percentage of CD177 expressing neutrophils in patients with ANCA-associated vasculitis and systemic lupus erythematosus PMID: 19185066

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.