Recombinant Human Cd160 Antigen (CD160) Protein (His), Active

Name: Recombinant Human Cd160 Antigen (CD160) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05626P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Co-inhibitory receptors, Fc receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cd160 Antigen (CD160) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml.
Uniprotkb	O95971
Target Symbol	CD160
Synonyms	BY55; BY55_HUMAN; CD160; CD160 antigen [Precursor]; CD160 antigen; CD160 delta Ig; CD160 molecule; CD160 transmembrane isoform; FLJ46513; Natural killer cell receptor BY55; Natural killer cell receptor; immunoglobulin superfamily member; NK1; NK28
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Expression Range	27-159aa
Protein Length	Full Length of Mature Protein
Mol. Weight	15.8 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells. Receptor for both classical and non-classical MHC class I molecules. In the context of acute viral infection, recognizes HLA-C and triggers NK cell cytotoxic activity, likely playing a role in anti-viral innate immune response. On CD8+ T cells, binds HLA-A2-B2M in complex with a viral peptide and provides a costimulatory signal to activated/memory T cells. Upon persistent antigen stimulation, such as occurs during chronic viral infection, may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion. On endothelial cells, recognizes HLA-G and controls angiogenesis in immune privileged sites. Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response. On activated CD4+ T cells, interacts with TNFRSF14 and downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response. In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and proinflammatory cytokines.; The soluble GPI-cleaved form, usually released by activated lymphocytes, might play an immune regulatory role by limiting lymphocyte effector functions.
Subcellular Location	[CD160 antigen]: Cell membrane; Lipid-anchor, GPI-anchor.; [CD160 antigen, soluble form]: Secreted.
Database References	HGNC: 17013 OMIM: 604463 KEGG: hsa:11126 STRING: 9606.ENSP00000235933 UniGene: PMID: 25470765 Data suggest that CD160 may become a useful marker in the clinical diagnosis and prognosis of chronic lymphocytic leukemia. PMID: 24882258 elevated CD160 expression on natural killer (NK) cells plays an important role in NK cell loss in atherosclerosis. PMID: 26071079 CD160-expressing human NK cells are costimulated by HVEM expressed in the environment to enhance cytolytic function and cytokine production. PMID: 23761635 analysis of how NK1 receptor Gs versus Gq proteins and beta-arrestin signaling is determined by interactions in the water hydrogen bond network PMID: 26269596 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies PMID: 25449536 CD160FCA offers a simple assay for minimal residual disease detection in CLL and gives prognostic information across different CLL risk groups. PMID: 25615279 report high frequencies of CD160 on CD8+ T cells, with significantly higher levels on HTLV-1 specific CD8+ T cells PMID: 25277889 A population of CD4+ CD160+ T lymphocytes was identified in circulating cutaneous T cells. PMID: 25044837 Antibodies targeting CD160-GPI complement the blockade of PD-1 to enhance HIV-specific T-cell responses and warrant further investigation in the development of novel immunotherapeutic approaches. PMID: 25179432 CD160 and PD-1 co-expression on HIV-specific CD8 T cells defines a subset with advanced dysfunction. PMID: 22916009 results indicate that CD160+ lymphocytes could be able to play a role in the maintenance of healthy pregnancy PMID: 21276121 circulating NK cells from PNH patients exhibit a self-MHC class I molecule reactive effector function, which could be mediated through the recruitment of CD160-TM receptor. PMID: 22172098 The results of a mutagenesis study of HVEM suggest that the CD160 binding region on HVEM was slightly different from, but overlapped with, the BTLA binding site. PMID: 21959263 demonstrated CD160 expression in 98% of chronic lymphocytic leukemia cases, 100% of hairy cell leukemia cases, 15% of mantle cell lymphoma in the leukemic phase, and 16% of other B-cell lymphoproliferative disorders PMID: 21715317 A novel antiangiogenic and vascular normalization therapy targeted against human CD160 receptor. PMID: 21482699 soluble CD160, produced by mast cells, may have a role in T-cell-mast cell interactions in vivo PMID: 21191401 Activation through CD160 leads to PI3K-dependent chronic lymphocytic leukemia protection from spontaneous in vitro apoptosis, as well as cellular activation with cell cycle progression and cytokine production. PMID: 20164468 BY55 functions as a co-receptor in TCR signal transduction of a human cytotoxic effector T lymphocyte subset lacking CD28 expression PMID: 11978774 CD94-expressing cells with cytolytic activity against the recipient's leukemic and tumor cells without enhancement of alloresponse might be able to be expanded from donor G-PBMCs. PMID: 15073036 The CD160 receptor represents a unique triggering surface molecule expressed by cytotoxic NK cells that participates in the inflammatory response and determines the type of subsequent specific immunity. PMID: 15494480 We report that CD160 acts as a co-activator receptor for CD3-induced proliferation of CD4+ CD160+ T cells isolated from inflammatory skin lesions. PMID: 17218942 short-time incubation of NK lymphocytes with IL-15 converts the membrane-bound CD160 to a soluble form; activated NK lymphocytes release a soluble form of CD160 that functionally impairs the MHC-I-specific cytotoxic CD8(+) T lymphocyte responsiveness PMID: 17237375 CD160 serves as a negative regulator of CD4+ T cell activation through its interaction with HVEM. PMID: 18193050 Apart from CD160 mRNA, three additional transcripts generated through alternative splicings of the CD160 gene can be detected in peripheral blood natural killer (NK) cells but not in peripheral blood CD8-positive T cells, upon activation. PMID: 19109136 Site-directed mutagenesis showed that the predicted AML-1 site is essential for the regulation of CD160 gene expression. PMID: 19626042

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.