Recombinant Human Ccr4-Not Transcription Complex Subunit 7 (CNOT7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00270P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Ccr4-Not Transcription Complex Subunit 7 (CNOT7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00270P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ccr4-Not Transcription Complex Subunit 7 (CNOT7) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9UIV1 |
| Target Symbol | CNOT7 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
| Expression Range | 1-285aa |
| Protein Length | Full Length |
| Mol. Weight | 36.8 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity. |
| Subcellular Location | Nucleus. Cytoplasm, P-body. |
| Protein Families | CAF1 family |
| Database References | HGNC: 14101 OMIM: 604913 KEGG: hsa:29883 STRING: 9606.ENSP00000355279 UniGene: PMID: 28591869 |
