Recombinant Human Ccn Family Member 5 (CCN5) Protein (GST)

Name: Recombinant Human Ccn Family Member 5 (CCN5) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09130P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ccn Family Member 5 (CCN5) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O76076
Target Symbol	CCN5
Synonyms	CCN family member 5; CCN5 ; Connective tissue growth factor like protein; Connective tissue growth factor related protein 58 ; Connective tissue growth factor-like protein; Connective tissue growth factor-related protein 58; CT58 ; CTGF L; CTGF-L; WISP 2; WISP-2; Wisp2; WISP2_HUMAN; Wnt 1 signaling pathway protein 2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Expression Range	1-250aa
Protein Length	Full Length
Mol. Weight	51.3kDa
Research Area	Stem Cells
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Subcellular Location	Secreted.
Protein Families	CCN family
Database References	HGNC: 12770 OMIM: 603399 KEGG: hsa:8839 STRING: 9606.ENSP00000190983 UniGene: PMID: 28450698 by analyzing different estrogen receptor-alpha(ER-a)-positive and ER-a-negative breast cancer cell lines, we defined the role of CCN5 in the leptin-mediated regulation of growth and invasive capacity. PMID: 29370782 CCN3 (Nov) and CCN5 (WISP2) are novel substrates of MMP14. PMID: 27471094 Results show that WISP2 and beta-catenin were more highly expressed in gastric cancer tissues and seem to correlate with early stage or without metastasis. PMID: 28739741 Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta. PMID: 26218313 Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups). PMID: 25089371 Activation of CCN5 may have the therapeutic potential to kill triple-negative breast cancer. PMID: 25132260 WISP2 has a role in regulating tumor cell susceptibility through EMT by inducing the TGF-beta signaling pathway, KLF-4 expression and miR-7 inhibition. PMID: 24931170 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia. PMID: 25509878 overexpression of FGFBP1 or loss of WISP-2 expression is closely related to the metastasis, invasion and poor prognosis of gallbladder cancer. PMID: 23592278 Loss of WISP2 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype. PMID: 24498388 We demonstrate that the overexpression of CCN5 in lung fibroblasts suppresses the upregulation in the expression of alpha-SMA and collagen induced by CCN2. PMID: 24276150 WISP2 exerts dual actions in mesenchymal precursor cells; secreted WISP2 activates canonical WNT and maintains the cells in an undifferentiated state, whereas cytosolic WISP2 regulates adipogenic commitment. PMID: 24451367 Regulation of invasion by WISP2 may involve the WNT signalling pathway. PMID: 23893926 WISP2 regulates preadipocyte commitment and PPARgamma activation by BMP4. PMID: 23359679 WISP2 gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue. PMID: 22616691 Studies suggest a novel regulatory pathway exists through which CCN5 exerts its anti-invasive function. PMID: 22020939 CCN5 represses expression of genes associated with epithelial-mesenchymal transition (EMT) as well as expression of key components of the transforming growth factor beta (TGF-beta) signaling pathway. PMID: 21262769 The CCN5/WISP2 were downregulated in paired comparisons of plexiform neurofibroma and malignant peripheral nerve sheath tumor. PMID: 20010302 Overexpression of WISP2 is associated with breast cancer PMID: 11855747 disruption of WISP-2 signaling by use of antisense oligomers caused a significant reduction in breast tumor cell proliferation PMID: 12659671 WISP2 was overexpressed in gastrointestinal peptide-independent ACTH-independent macronodular adrenal hyperplasia. PMID: 14767469 regulation of phosphorylation of ER-alpha and EGFR may play critical roles in EGF-induced transcriptional activation of WISP-2 gene in breast tumor cells PMID: 15798095 These data demonstrate that the expression of WISP2 is synergistically upregulated in RA synovial fibroblasts by estrogen and WNT pathways, and suggest an involvement in the pathology of the disease. PMID: 16038875 Results suggest that WISP-2 could be a reliable independent marker and that down-regulation or loss of the WISP-2 gene may be associated with the development of salivary gland tumors. PMID: 16525711 WISP-2/CCN5 is a novel signaling molecule that critically participates in the mitogenic action of PMA on noninvasive, WISP-2/CCN5-positive breast tumor cells through PKCalpha-dependent, multiple molecular signal transduction pathways. PMID: 16939222 Data suggest WISP-2/CCN5 silencing may be a critical event during differentiation and progression of pancreatic adenocarcinoma. PMID: 17383817 WISP-2 had greater levels of expression in node-positive tumors; higher levels in both moderate and poor prognostic groups compared with the good prognostic group; greater level in both grade 2 and 3 when compared with grade 1. PMID: 17406949 WISP-2/CCN5 is an important regulator involved in the maintenance of a differentiated phenotype in breast tumor epithelial cells and may play a role in tumor cell invasion and metastasis PMID: 18070926 Loss of CCN5 is associated with gain of oncogenic function of p53 mutants invasiveness in breast cancer PMID: 18559502 CCN5 mRNA and protein level was almost undetectable in poorly differentiated breast cancers compared with the moderately or well-differentiated samples and its expression inversely correlated with lymph node positivity. PMID: 18794149

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.