Recombinant Human Ccn Family Member 2 (CCN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02338P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ccn Family Member 2 (CCN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02338P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ccn Family Member 2 (CCN2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P29279 |
Target Symbol | CCN2 |
Synonyms | CCN 2; CCN family member 2; CCN2; Connective tissue growth factor; Ctgf; CTGF_HUMAN; Hcs 24; Hcs24; Hypertrophic chondrocyte specific protein 24; Hypertrophic chondrocyte-specific gene product 24 ; Hypertrophic chondrocyte-specific protein 24; IBP-8; IGF-binding protein 8; IGFBP-8; IGFBP8; Insulin like Growth Factor Binding Protein 8; Insulin-like growth factor-binding protein 8; MGC102839; NOV 2; NOV2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
Expression Range | 253-349aa |
Protein Length | Partial |
Mol. Weight | 15.1kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. Secreted. |
Protein Families | CCN family |
Database References | HGNC: 2500 OMIM: 121009 KEGG: hsa:1490 STRING: 9606.ENSP00000356954 UniGene: PMID: 28463604 |