Recombinant Human CCL21 Protein (N-6xHis-GST)
Beta LifeScience
SKU/CAT #: BLC-11415P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human CCL21 Protein (N-6xHis-GST)
Beta LifeScience
SKU/CAT #: BLC-11415P
Regular price
$94900
$949.00
Sale price$24000
$240.00Save $709
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Purity | Greater than 85% as determined by SDS-PAGE. | |
Uniprotkb | O00585 | |
Target Symbol | CCL21 | |
Species | Human | |
Expression System | E.coli | |
Tag | N-terminal 6xHis-GST-tagged | |
Target Protein Sequence | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP | |
Expression Range | 24-134aa | |
Protein Length | Full Length of Mature Protein | |
Mol. Weight | 43.8 kDa | |
Research Area | Immunology | |
Form | Liquid or Lyophilized powder | |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. | |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. | |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | |
Target Function | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. | |
Subcellular Location | Secreted. | |
Protein Families | Intercrine beta (chemokine CC) family | |
Database References |
HGNC: 10620 OMIM: 602737 KEGG: hsa:6366 STRING: 9606.ENSP00000259607 UniGene: Tissue Specificity |
Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart |