Recombinant Human CCL11 Protein
Beta LifeScience
SKU/CAT #: BL-0160PS
Recombinant Human CCL11 Protein
Beta LifeScience
SKU/CAT #: BL-0160PS
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | N/A |
Host Species | Human |
Synonym | Small inducible cytokine A11, CCL11, Eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCYA11, MGC22554. |
Background | Chemokine (C-C motif) ligand 11 (CCL11) is a small cytokine belonging to the CC chemokine family that is also known as eotaxin. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. The effects of CCL11 are mediated by its binding to a G-protein-linked receptor known as a chemokine receptor. Chemokine receptors for which CCL11 is a ligand include CCR2, CCR3 and CCR5. The gene for human CCL11 (scya11) is encoded on three exons and is located on chromosome 17. |
Description | Eotaxin Human Recombinant expressed in E.Coli is a single, non-glycosylated polypeptide chain containing 74a.a. and having a molecular weight of 8345.9 Dalton. The CCL11 is purified by unique purification methods. |
Source | E.coli |
AA Sequence | GPASVPTTCC FNLANRKIPL QRLESYRRIT SGKCPQKAVI FKTKLAKDICADPKKKWVQDSMKYLDQKSP TPKP. |
Purity | >97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Bioactivity | The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 0.1-10 ng/ml corresponding to a Specific Activity of 100,000-10,000,000IU/mg. |
Formulation | Lyophilized from a 0.2µm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 150mM NaCl. |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Lyophilized Eotaxin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL11 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Target Details
Target Function | In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References |
Gene Functions References
- These results suggest CCL11 as a candidate biomarker for the prediction of acute and long-term functional outcomes in ischemic stroke patients PMID: 28634890
- analyzed the genotypes of 6 tag SNPs in the CCL11 gene (rs1129844, rs17809012, rs1860183, rs1860184, rs4795898, and rs4795895) in a case control study. We found the GG genotype of rs4795895 was significantly associated with increased risk of lacunar stroke and the GA genotype of rs17809012 was associated with a significant increase in risk of LAA stroke PMID: 28873081
- CCL11 promotor polymorphism is associated with increased risk for the development of schizophrenia in a Korean population. PMID: 29477870
- Findings suggest that CCL11-CCR3 binding is involved in the progression of GBM. PMID: 27119233
- There were no significant differences in GE area of infertile and fertile women. C-C motif chemokine 11 (P=0.048), TGFalpha (P=0.049), IFNgamma (P=0.033) and interleukin-1 alpha (P=0.047) were significantly elevated in uterine lavage from infertile women <35years compared to fertile but not in women 35years PMID: 27525354
- eotaxin promotes proliferation in vascular smooth muscle cells and triggers oxidative stress in a NADPH oxidase dependent manner. PMID: 27681294
- a receiver operating characteristic (ROC) curve analysis demonstrated CSF CCL11 accurately distinguished CTE subjects from non-athlete controls and AD subjects PMID: 28950005
- These studies characterized serum and intestinal wall eotaxin-1 levels in various inflammatory bowel disease patients and to explore the effect of targeting eotaxin-1 by specific antibodies in dextran sodium sulfate-induced colitis model. PMID: 26874691
- this study shows that expression of CCL11 is increased in eosinophilic myocarditis patients compared to chronic lymphocytic myocarditis patients PMID: 27621211
- Review: eotaxins (CCL11, CCL24, and CCL26) play key role(s) during symptomatic inflammatory responses raised in response to allergic crisis of allergic asthma and atopic dermatitis PMID: 26861136
- increased amounts released by neutrophils from fibromyalgia patients PMID: 26341115
- Eotaxin measured on the day of birth is useful for identifying extremely low birth weight infants at risk of bronchopulmonary dysplasia/death. PMID: 26270578
- The results of this study suggested that eotaxin-1 as a novel modifier of Alzheimer's disease age at onset and open potential avenues for therapy. PMID: 26324103
- ANDV caused long-term elevated levels of eotaxin-1, IL-6, IL-8, IP-10, and VEGF-A that peaked 20-25 days after infection PMID: 26907493
- The A allele in eotaxin 67 G/A polymorphism is associated with worse survival in CAD patients. PMID: 26491210
- Findings demonstrate a link between CCL11 and primary Sjogren's syndrome disease activity and lymphoma. PMID: 26359802
- Serum and urinary CCL11 were decreased in patients with prostate cancer compared with controls. PMID: 26306920
- Results show the structure of CCL11 bound to the sulfated N-terminal region of its receptor CCR3 and show that intact CCR3 is sulfated and sulfation enhances receptor activity. PMID: 25450766
- SF of BC OA displayed significantly higher concentrations for a number of proinflammatory cytokines [CXCL1, eotaxin, interferon (IFN)-gamma, interleukin (IL)-7, IL-8, IL-9, IL-12]. PMID: 25393692
- Taken together, these findings indicate that inhibiting IL-4-induced eotaxin-1 expression by synephrine occurs primarily through the suppression of eosinophil recruitment, which is mediated by inhibiting STAT6 phosphorylation. PMID: 25111027
- eotaxin-1 increases MMP-3 expression via the CCR3-ERK pathway, thereby promoting prostate cancer cell invasion and migration. PMID: 24604010
- the CCL11 GG genotype is a significant risk factor for ischemic as well as hemorrhagic stroke. Further, the frequency of the GG genotype was observed to be higher in hemorrhagic stroke patients in comparison with ischemic stroke. PMID: 25237944
- CCL11 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
- thi is a study of the interaction between vCCI and eotaxin-1 (CCL11), a CC chemokine that is an important factor in the asthma response. PMID: 24482230
- Cannabis use was found to increase CCL11 plasma levels and the effects were reversed when cannabis use ceases. PMID: 23820464
- CCL11, CCL24, and CCL26 are increased in TB patients; hence, it seems that TB suppresses Th1 and the classic function of macrophages subsequently by inducing the chemokines' expression PMID: 24600981
- CCL11, CCL24, and CCL26 has a role in the recruitment of extravillous trophoblast into decidual tissue and vessels. PMID: 23477905
- CCL11 contributes to eosinophil recruitment in UC and that intestinal myeloid cells are a source of CCL11. PMID: 23904440
- These data uncover a previously unknown role for NRF2 in regulating Eotaxin-1 expression and further the mechanistic understanding of this pathway in modulating inflammatory lung disease. PMID: 23061798
- The impact of three single-nucleotide polymorphisms in eotaxin (SCYA11) gene promoter (-426C>T and -384A>G) and first exon (67G>A) and recently described hexanucleotide (GAAGGA)(n) 10.9 kb upstream on coronary atherosclerosis was investigated. PMID: 22773402
- Serum levels for CCL1 (I-309) were significantly elevated among all men with enlarged prostates (P < 0.04). Serum levels for CCL11 (Eotaxin-1) were significantly elevated among men with prostate cancer regardless of prostate size (P < 0.01). PMID: 23059958
- The Marfan syndrome patients with lowest mental quality of life and vitality scores had high levels of CCL11 cytokine. PMID: 23049769
- Study found that the plasma concentration of eotaxin was associated with the clinical severity of chronic rhinosinusitis in Taiwanese patients. PMID: 22271279
- The level of eotaxin expression and inflammatory cell count were measured in the material from nasal brushing in healthy controls and in patients with allergic rhinitis, asthma, and chronic obstructive pulmonary disease. PMID: 22846146
- the eotaxin/CCL11-CCR3 axis is active in idiopathic retroperitoneal fibrosis (IRF) and may contribute to its pathogenesis; the TTCCAT haplotype within the CCL11 gene is significantly associated with IRF PMID: 23114905
- Serum CCL17, IL-8, and eotaxin levels were significantly increased in eosinophilic subjects as compared to normal controls, but were similar between Churg-syndrome and hypereosinophilic syndrome. PMID: 22775568
- Eotaxin-1 not only induces MMP-3 gene expression but also promotes MMP-3 protein secretion through G protein-coupled eotaxin-1 receptor activities. PMID: 22114952
- Pretreated CCD-11Lu cells with noncytotoxic doses (0.1-10 muM) of CAPE inhibited the production of eotaxin under stimulation of IL-4 and tnf-alpha.CAPE pretreatment decreased the amount of pSTAT6 and STAT6 DNA binding complexes in nuclear extracts. PMID: 21601544
- In this study, eotaxin-1 -384 A>G or 67 G>A genotypes were not associated with susceptibility to Nasal Polyposis. PMID: 21825098
- Data show that expression levels of CCL11 and CCR3 mRNA in the lesional skin of ALCL were significantly higher than those in normal skin. PMID: 21406396
- After corticosteroid therapy, the expressions of Eotaxin and Eotaxin-2 in mucosal epithelia of nasal polyps were significantly decreased. PMID: 19522186
- Eotaxin induces proliferation of nonasthmatic airway smooth muscle cells and decreases their rate of apoptosis. PMID: 21368236
- The expression of Eotaxin-1 and -2 in nasal polyposis and polyps was dramatically higher than in controls. PMID: 17438849
- Corticosteroid treatment of nasal polyps reduced expression of CCL11. PMID: 17438850
- Measurements of eotaxin-1 in exhaled breath condensate of asthma patients may provide a useful diagnostic tool for detecting and monitoring airway inflammation and disease severity. PMID: 20704746
- Serum CCL18 level was significantly decreased in epithelial ovarian cancer patients with early stages compared to those with late stages. PMID: 19937162
- elevated levels of eotaxin in children with stable asthma; correlation with eosinophilia PMID: 20444156
- Eotaxin may up-regulate the expression of VCAM-1 in vessel endothelium and promote adhesion and migration of eosinophils, as a result, to lead to the recurrence of nasal polyps. PMID: 16874958
- Serum CCL11 was increased in ulcerative colitis (UC) and less in Crohn's disease (CD), whereas CCL24 and CCL26 were increased only in UC. Colon expression of the CCL's was higher in UC vs. CD, and was induced by Th2 cytokines in colon epithelial cells. PMID: 21077277
- SOCS1 and 3 may control chemotaxis and adhesion PMID: 20934424