Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc)

Name: Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-05141P
Availability: InStock

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CEBPD.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P49716
Target Symbol	CEBPD
Synonyms	C/EBP delta; C/EBP related protein 3; CCAAT/enhancer binding protein (C/EBP) delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBP D; CEBPD; CEBPD_HUMAN; CELF; Crp 3; Crp3; NF IL6 beta; NF-IL6-beta; Nuclear factor NF IL6 beta; Nuclear factor NF-IL6-beta
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Expression Range	2-269aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB.
Subcellular Location	Nucleus.
Protein Families	BZIP family, C/EBP subfamily
Database References	HGNC: 1835 OMIM: 116898 KEGG: hsa:1052 STRING: 9606.ENSP00000386165 UniGene: PMID: 29644527 tudy underscores how CEBPD functions at the junction of inflammation and lipid accumulation in M1 macrophages PMID: 28859294 the EGFR/STAT3 pathway contributed to CDDP-induced CEBPD expression in UCUB cells. Gefitinib and S3I-201 treatment significantly reduced the expression of CEBPD and enhanced the sensitivity of CDDP-resistant UCUB cells to CDDP and paclitaxel PMID: 27435393 These findings demonstrate a critical function for the astrocytic CEBPD, and point to miR-135a antagonist as an attractive therapeutic target for the treatment of Alzheimer's disease. PMID: 26208701 These findings identify a molecular mechanism by which ERalpha signaling reduces the aggressiveness of cancer cells, and demonstrate that C/EBPdelta can have different functions in different types of cancer. PMID: 27181204 CREB overexpression increased CCAAT-enhancer-binding protein-delta (C/EBPdelta) levels to cause myeloid differentiation arrest, and the silencing of CREB-C/EBPdelta axis restored myeloid terminal differentiation PMID: 27118402 Data suggest that proinflammatory cytokine interleukin-1beta (IL1B) up-regulates hepcidin expression in hepatocytes; inflammation induces IL1B production in Kupffer cells and hepatocytes; IL1B up-regulates CEBPD (CCAAT/enhancer binding protein delta) expression in hepatocytes; up-regulation of CEBPD expression up-regulates hepcidin transcription. PMID: 28438835 the C/EBPD binding site is required for RU486-mediated activation of the CHOP promoter. PMID: 26174226 Results suggest that CCAAT/enhancer binding protein delta (CEBPD) could be a useful diagnostic marker and therapeutic target in hepatocellular carcinoma (HCC). PMID: 26358750 CEBPD amplification and overexpression is associated with urothelial carcinoma. PMID: 26307680 Knock-down of C/EBPdelta expression in pericytes following immune stimulation increased chemokine and adhesion molecule expression. PMID: 26166618 We have discovered the CEBPD-hypoxia-inducible factor-1 (HIF-1) pathway as a new HIF-1-regulating fundamental mechanism in tubular epithelial cells for the cellular protection against kidney injury. PMID: 25692954 Authors found that CK2 bound to C/EBPdelta, which might help to target CK2 to the transcriptional machinery where it can phosphorylate other transcription factors or co-activators. PMID: 25680545 Data indicate that dysfunction of the Rho-associated kinase 2 (Rock2)-p-GSK3beta/beta-catenin-CCAAT/enhancer-binding protein delta (CEBPD) regulatory circuitry may contribute to the tumorigenic characteristic of hepatocellular carcinoma (HCC). PMID: 25771860 GSK3beta-mediated CEBPD phosphorylation in astrocytes plays an important role in the activation of microglia. PMID: 23993701 the inflammatory PGE-HuR-C/EBPdelta axis in macrophages promotes tumor progression by preventing the phagocytosis of tumor cells and inducing immunosuppressive cytokine production. PMID: 23861541 CEBPD inhibits FBXW7 expression and augments HIF-1 alpha expression and activity under hypoxia PMID: 21076392 CEBPD supports inflammatory signaling through activation of the TLR4 gene; and is downregulated by FBXW7 alpha following phosphorylation by GSK-3 beta. PMID: 23575666 Review article on CEBPD expression, regulation and function with focus on inflammation and cancer. PMID: 24155666 The FRA8I fragile site includes KIAA0146, CEBPD and PRKDC and may have a role in colorectal cancer PMID: 23603433 Findings suggest that CEBPD and its downstream effectors could be biomarkers for the diagnosis of RA and potentially serve as therapeutic targets for RA therapy. PMID: 23028973 This study provides the first demonstration of a role for astrocytic CEBPD and the CEBPD-regulated molecule PTX3 in the accumulation of damaged neurons, which is a hallmark of AD pathogenesis. PMID: 21112127 Src kinase activity downregulates C/EBP-delta protein but not mRNA levels through a SIAH2 E3 ligase-dependent mechanism. PMID: 22037769 new function of CEBP-delta in lymphangiogenesis through regulation of VEGFR3 signaling in lymphatic endothelial cells PMID: 21666710 Data indicate that C/EBPdelta plays a role in late stages of keratinocyte differentiation. PMID: 21072181 HMDB kills cancer cells through activation of CEBPD pathways. PMID: 20971808 C/EBP{delta} and STAT-1 are required for TLR8 transcriptional activity. PMID: 20829351 Common allelic variants in CEBPD were not associated with obesity phenotypes in healthy White Northern European families. PMID: 20460359 found that C/EBPdelta promotes monoubiquitination of the Fanconi anemia complementation group D2 protein (FANCD2), which is necessary for its function in replication-associated DNA repair PMID: 20805509 C/EBPdelta expression may prevent the development of recurrences by inhibition of neoplastic growth in meningiomas PMID: 19806320 Expression of CEBPD reduces cisplatin-induced reactive oxygen species and apoptosis in NTUB1 carcinoma cells by inducing the expression of copper/zinc-superoxide dismutase via direct promoter transactivation. PMID: 20385105 These results suggest a potentially crucial role for NF-kappaB in the IL-1-induced expression of C/EBPdelta, and thereby downstream acute phase protein genes regulated by this transcription factor. PMID: 19800021 A single nucleotide polymorphism in the CEBPD gene was found in 2.9% of patients studied. PMID: 11851384 posttranscriptional and posttranslational regulation in G0 growth-arrested mammary epithelial cells PMID: 12554732 Expression levels of C/EBPdelta in breast tumors were correlated with clinicopathological tumor parameters, expression of estrogen and progesterone receptors (ER, PR), Ki67 immunostaining, and expression of 7 cell-cycle regulatory proteins. PMID: 12825852 C/EBPdelta has a role in abolishing CBP phosphorylation as well as transcriptional activation and could be important in C/EBP-mediated transcription PMID: 12857754 AD tissue sections revealed profuse C/EBPdelta staining of astrocytes, particularly reactive astrocytes surrounding amyloid beta peptide deposits. Substantially less immunoreactivity was observed in comparable sections from controls. PMID: 15212823 results indicate that the C/EBPdelta gene is controlled at multiple levels, consistent with a role for C/EBPdelta in cell cycle control and/or cell fate determination. PMID: 15389878 results demonstrate that "loss of function" alterations in the pSTAT3/C/EBPdelta growth inhibitory signal transduction pathway are relatively common in breast cancer cell lines PMID: 15389879 C EBP delta is a downstream mediator of IL-6 induced growth inhibition of prostate cancer cells. PMID: 15486993 Expression of C/EBPdelta in BCR-ABL-positive leukemic cells in blast crisis is sufficient for neutrophil differentiation. PMID: 15674331 IL-6 increases hepatic PAI-1 expression mediated by the -232- to -210-bp region of the promoter containing a C/EBPdelta binding site. PMID: 15718495 the PI3-kinase/p38(MAPK)/CREB pathway contributes to the EGF activation of NF-IL6beta gene expression PMID: 15901830 Small interfering RNA of C/EBPdelta suppressed COX-2 expression, strengthening the role of C/EBPdelta in COX-2 gene transcription. PMID: 16195339 Reduced C/EBPdelta gene expression is associated with breast tumors PMID: 16322893 IL-1 and IL-6 exert directionally similar effects on PAI-1 expression, but the induction involves distinct signaling pathways with a final common mediator, C/EBPdelta. PMID: 16914534 Reverse-transcription polymerase chain reaction confirmed increased expression of GADD45A, BTG2, PDE4B, and CEBPD and downregulation of TOB1 in skeletal muscle intradialysis. PMID: 16997058 C/EBPdelta is a novel tumor suppressor gene in acute myeloid leukemia that is silenced by promoter methylation. PMID: 17234736 C/EBPdelta ubiquitination is not required for proteasome-mediated C/EBPdelta degradation and the presence of ubiquitin does not increase C/EBPdelta degradation by the proteasome. PMID: 17373909 C/EBPdelta, but not DeltaNp63alpha, indefinitely promotes holoclone self-renewal and prevents clonal evolution, suggesting that self-renewal and proliferation are distinct, albeit related, processes in limbal stem cells. PMID: 17562792

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.