Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05141P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CEBPD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CEBPD.
Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05141P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ccaat/Enhancer-Binding Protein Delta (CEBPD) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P49716 |
| Target Symbol | CEBPD |
| Synonyms | C/EBP delta; C/EBP related protein 3; CCAAT/enhancer binding protein (C/EBP) delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBP D; CEBPD; CEBPD_HUMAN; CELF; Crp 3; Crp3; NF IL6 beta; NF-IL6-beta; Nuclear factor NF IL6 beta; Nuclear factor NF-IL6-beta |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR |
| Expression Range | 2-269aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.8 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB. |
| Subcellular Location | Nucleus. |
| Protein Families | BZIP family, C/EBP subfamily |
| Database References | HGNC: 1835 OMIM: 116898 KEGG: hsa:1052 STRING: 9606.ENSP00000386165 UniGene: PMID: 29644527 |
