Recombinant Human Cation-Independent Mannose-6-Phosphate Receptor (IGF2R) Protein (His-Myc)

Name: Recombinant Human Cation-Independent Mannose-6-Phosphate Receptor (IGF2R) Protein (His-Myc)
Brand: Beta LifeScience
SKU: BLC-06774P
Price: 501.6 USD
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cation-Independent Mannose-6-Phosphate Receptor (IGF2R) Protein (His-Myc) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P11717
Target Symbol	IGF2R
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	C-6His-Myc
Target Protein Sequence	LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Expression Range	628-772aa
Protein Length	Partial
Mol. Weight	20.7 kDa
Research Area	Transport
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Subcellular Location	Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.
Protein Families	MRL1/IGF2R family
Database References	HGNC: 5467 OMIM: 147280 KEGG: hsa:3482 STRING: 9606.ENSP00000349437 UniGene: Hs.487062

Gene Functions References

M. tuberculosis-initiated human mannose receptor signaling regulates macrophage recognition and vesicle trafficking by gamma Fc receptors, Grb2, and SHP-1. PMID: 28978467
IGF2R deletion is associated with motor speech disorders, and language delays. PMID: 28767196
Heterodimers of the SNX-BAR proteins, SNX1, SNX2, SNX5, and SNX6, are the cargo-selective elements that mediate the retrograde transport of CI-MPR from endosomes to the trans-Golgi networ independently of the core retromer trimer. PMID: 28935632
Sequence-dependent cargo recognition by SNX-BARs mediates retromer-independent transport of CI-MPR. PMID: 28935633
Findings indicate that IGF2R expression is controlled posttranscriptionally by two factors that associate with Igf2r mRNA and suggest that miR-195 and CUGBP1 dampen IGF signaling by inhibiting IGF2R translation. PMID: 28716948
Data show one single nucleotide polymorphism (SNP) in Fox transcription factor FOXO3 (FOXO3) was significantly associated with longevity, and the six SNPs in proto-oncogene protein AKT1 (AKT1) gene and in IGF-2 Receptor (IGF-2R) gene are not. PMID: 26683100
CREB plays an important role in the inhibition of IGF2R expression by binding to the IGF2R promoter and further suppresses H9c2 cardiomyoblast cell apoptosis induced by IGF2R signaling under hypoxic conditions. PMID: 26610485
This study showed that Plasma IGF2R levels were positively correlated with plasma HIV viral load. PMID: 25890304
IGF2R gene polymorphism and circulating IGF2R are associated with T2DM PMID: 25922844
The macrophage-specific markers CD163, soluble CD163, and soluble MR are increased in septic patients. PMID: 24637679
Results show that insulin-like growth factor II (IGF-II) overexpression enhanced the levels of amyloid precursor protein (APP) in SK-N-AS neuroblastoma cells. PMID: 25939386
IGF2R silencing significantly enhanced the chemo-resistance of NSCLC cell lines to cisplatin treatment. PMID: 25402559
Report genes involved in trafficking of the mannose 6-phosphate receptors between the trans-Golgi network, endosomes and the plasma membrane. PMID: 25278553
CD222 specifically controls the balance between active and inactive Lck in resting T cells, which guarantees operative T cell effector functions. PMID: 25127865
Synergistic interactions were detected between SNPs, including a non-synonymous SNP, and diplotypes within IGF2R and ADAMTS19 which may contribute to POF. PMID: 24014609
AGE-RAGE-induced oxidative stress stimulates the release of endothelial cell DPP-4, which could in turn act on ECs directly via the interaction with M6P/IGF-IIR, further potentiating the deleterious effects of AGEs. PMID: 23984879
The ubiquitin ligase RNF126 has a role in the retrograde sorting of the CI-MPR. PMID: 24275455
these data suggest that M6P/IGF-IIR silencing alone is insufficient to confer a tumorigenic phenotype, but can enhance tumorigenicity in an already transformed cell. PMID: 23686499
Results showed that insulin-like growth factor 2 ApaI and IFG2R Gly1619Arg gene polymorphisms are not associated with male infertility. PMID: 23539881
The mannose 6-phosphate-binding sites of M6P/IGF2R determine its capacity to suppress matrix invasion by squamous cell carcinoma cells. PMID: 23347038
Data indicate that the levels of IGF-2R and IGFBP-2 in hepatocellular carcinoma (HCC) tissues were higher than those in adjacent tissues. PMID: 23071652
The 5-phosphatase OCRL mediates retrograde transport of the mannose 6-phosphate receptor by regulating a Rac1-cofilin signalling module. PMID: 22907655
demonstrate that functional mannose 6-phosphate(M6P)-binding sites are important for the anti-invasive properties of M6P/IGF2R PMID: 22521359
M6P/IGF2R truncation mutants may contribute to the cancer phenotype by decreasing the availability of full-length M6P/IGF2Rs to perform tumor-suppressive functions such as binding/internalization of receptor ligands PMID: 22681933
Serum IGF-2R levels were significantly higher in heart failure patients than in non-failing controls. After heart transplantation, serum IGF-2R levels increased, peaked at the first month, and decreased to near pre-transplantation levels at 6 months. PMID: 21895964
M6P-IGF2R appears to control plasminogen activation within cells that might be important to restrict plasmin activity to specific sites and substrates. PMID: 22613725
SNP at 8q24 makes diabetes a risk factor of colorectal cancer via IGF2R, especially in genetically non-risk allele cases. PMID: 22486879
No evidence that the IGF2R Gly1619Arg variation is associated with recurrent spontaneous abortions. PMID: 21627551
Data suggest that soluble CREG protein can exert its biological function via glycosylation-independent binding to the extracellular domains 11-13 of cell surface M6P/IGF2R, modulating SMC phenotypic switching from contractile to proliferative. PMID: 21195083
Leu(27)IGF2 promoted mitogenesis and survival only in explants with intact IGF2R expression. PMID: 20980691
M6P/IGF2R may be involved in HBV-associated hepatocarcinogenesis by the regulation of its expression level. PMID: 12736721
Imprinting of IGF2R gene in human is polymorphic, with a minority of individuals showing exclusive expression from the maternal allele. PMID: 8267611
IGF-2R gene polymorphisms are associated with the susceptibility and pathological development of hepatocellular carcinoma. PMID: 20119675
IGFIIR/M6PR is nutritionally regulated independently of IGF-II. PMID: 20110184
Importance of widening the epigenetic investigation of growth restriction to include multiple imprinted loci and highlights potential involvement of the IGF2R locus. PMID: 20104244
The 1.4 A resolution crystal structure of domain 11 was solved using the anomalous scattering signal of sulfur. It consists of two crossed beta-sheets forming a flattened beta-barrel with a putative IGF-II binding site is at one end. PMID: 11867533
cDNA probes were used to analyze the gene expression of IGF type 2 receptor in luteinized granulosa cells from different-sized follicles after ovarian hyperstimulation. PMID: 12005306
blocks apoptosis induced by herpes simplex virus 1 mutants lacking glycoprotein D and is likely the target of antiapoptotic activity of the glycoprotein. PMID: 12021353
Results suggest that M6P/IGF2R functions as a growth suppressor and its loss or mutation may contribute to development and progression of cancer. PMID: 12149131
Results suggest that a defect in a post-transcriptional process may exist during synthesis of the M6P/IGF2R in breast cancer cells, leading to failure to express sufficient functional M6P/IGF2R and resulting in the hypersecretion of procathepsin D. PMID: 12165733
1,25(OH)(2)D(3) treatment of Caco-2 cells results in activation of latent TGF-beta 1 facilitated by the enhanced expression of IGF-II receptor PMID: 12223346
findings are consistent with the hypothesis that the insulin-like growth factor-II/mannose 6-phosphate receptor suppresses tumor growth PMID: 12399424
data suggest that the insulin-like growth factor-II- and Mannose-6-Phosphate-binding functions of the insulin-like growth factor 2 receptor have opposing activities, with respect to growth of prostate cancer cells PMID: 12586773
the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
defect in USF function may contribute to down-regulation of IGF2R expression in cancer cells. PMID: 12857727
neutralization of serum IGF-II by sCIMPR plays a major role in IL-6-type cytokine-dependent cell proliferation. PMID: 12959977
The insulin-like growth factor receptor (IGF-IR) disruption may constitute an effective tool for the control of neovascularization PMID: 14710346
Review delineates what is currently known about IGF-II/M6P receptor structure, its ligand binding properties and role in lysosomal enzyme transport. It also summarizes the recent data regarding the role of the receptor in the central nervous system. PMID: 15003389
Nay play a direct role in tumour suppression or an indirect role as a transporter for ligands designated for degradation in the lysosomes. (review) PMID: 15156403
Increased frequency of the cation dependent-MPR C-allele in patients with major depression, but no involvement in Alzheimer disease noted. PMID: 15167696

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.