Recombinant Human Cathepsin S (CTSS) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03574P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Cathepsin S (CTSS) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03574P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Cathepsin S (CTSS) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P25774
Target Symbol CTSS
Synonyms Cathepsin S; CathepsinS; CATS_HUMAN; Ctss
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Expression Range 115-331aa
Protein Length Full Length of Mature Protein
Mol. Weight 28.0kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules and MHC class II antigen presentation. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L.
Subcellular Location Lysosome. Secreted. Cytoplasmic vesicle, phagosome.
Protein Families Peptidase C1 family
Database References

HGNC: 2545

OMIM: 116845

KEGG: hsa:1520

STRING: 9606.ENSP00000357981

UniGene: PMID: 29915952

  • The present data indicating that Cat-S activity increases with CKD progression suggest that Cat-S might be a therapeutic target to prevent cardiovascular complications in CKD. PMID: 28240259
  • High expression of CTSS was independently associated with lymph node metastasis (OR, 2.015; 95% CI, 1.225-3.315; P=0.006). Therefore, CTSS may serve as a predictive risk marker for the progression and prognosis of papillary thyroid cancer . PMID: 29749483
  • Authors show a significant increase of circulating CS levels in healthy female subjects induced by long-term physical activity. PMID: 29181829
  • This study therefore considerably improves our understanding of the molecular mechanism responsible for cathepsin S inhibition and facilitates the identification of potential novel selective inhibitors of cathepsin S. PMID: 28236030
  • cathepsin S is increased in periodontal cells and tissues under inflammatory and infectious conditions, suggesting a critical role of this autophagy-associated molecule in the pathogenesis of periodontitis. PMID: 29362520
  • Elevated cathepsin S activity was associated with collagen I degradation and thus might be involved in the progression of abdominal aortic aneurysms. PMID: 29624112
  • Cathepsin S was identified as the major IL-36gamma-activating protease expressed in epithelial cells. PMID: 28289191
  • Our results indicate that autophagy is essential for decreasing CTSS activity to inhibit tumor metastasis by hispolon treatment in cervical cancer; this finding provides a new perspective on molecular regulation. PMID: 28981104
  • These results revealed that CTSS can regulate EGFR signalling by facilitating EGF-mediated EGFR degradation. PMID: 27387133
  • This study suggested serum Cat S may be a potential biomarker for the diagnosis and prognosis of gastric cancer PMID: 27058412
  • Overall, these results indicate that exploitation of the cathepsin S activity in MPS tissues can be utilized to substantially lower non-target accumulation, suggesting this is a promising approach for the development of diagnostic and radiotherapeutic nanomedicine platforms. PMID: 27372424
  • polymorphism of rs7534124 and rs1136774 in cathepsin S promoter may decrease the susceptibility of asthma in a Chinese Han population PMID: 27249607
  • cathepsin S mRNA (CTSS), which encodes a cysteine protease associated with angiogenesis and atherosclerosis, is highly edited in human endothelial cells. RNA editing enables the recruitment of the stabilizing RNA-binding protein human antigen R (HuR; encoded by ELAVL1) to the 3' UTR of the CTSS transcript, thereby controlling CTSS mRNA stability and expression. PMID: 27595325
  • the essential role of autophagy-regulated early ROS in triggering late apoptotic signaling PMID: 26029922
  • Cathepsin S cleaves near the N-terminus of PAR2 to expose a novel tethered ligand, KVDGTS. PMID: 24964046
  • Increased plasma CTSS concentration is associated with atherogenesis. PMID: 24727728
  • potential marker of pruritus in dandruff/seborrhoeic dermatitis PMID: 24690038
  • results identify Cat-S as a biased agonist of PAR2 that causes PAR2- and TRPV4-dependent inflammation and pain. PMID: 25118282
  • Its stability at neutral pH and potent proteolytic activity on extracellular matrix components mean that cathepsin S may contribute significantly to cartilage degradation and may thus be considered a potential drug target in joint diseases. PMID: 23152404
  • High cathepsin S expression at the primary site correlates with decreased brain metastasis-free survival in breast cancer patients. PMID: 25086747
  • cathepsin S and chemerin only correlated positively with insulin resistance and inflammation PMID: 24390241
  • Cat S-mediated autophagic flux is an important mechanism for inducing M2-type polarization of tumor-associated macrophages, which leads to tumor development PMID: 24580730
  • Cathepsin S plays an important role in the regulation of autophagy and apoptosis in human glioblastoma cells. PMID: 24875536
  • Suppression of CD47 by morpholino approach suppressed growth of hepatocellular carcinoma in vivo and exerted a chemosensitization effect through blockade of CTSS/PAR2 signaling. PMID: 24523067
  • The miR-31/IRF-1/CTSS pathway may play a functional role in the pathogenesis of cystic fibrosis lung disease. PMID: 24940638
  • Markedly high levels of tear CTSS activity are suggestive of Sjogren syndrome. PMID: 24644101
  • This study reveals a noncanonical molecular pathway in which, after the inhibition of cathepsin S, autophagy induces early reactive oxygen species production for oxidative DNA damage and cell death through xanthine oxidase. PMID: 23892358
  • Amyloid-beta can regulate the proinflammatory state of human macrophages by inducing MMP-2/MMP-9/cathepsin S levels and by reducing TGF-beta1 secretion. PMID: 24335416
  • Cat S may participate in the pathophysiology of cystic fibrosis by weakening the antibacterial activity of SP-A. PMID: 23707200
  • the genetic polymorphisms of CTSS were associated with metabolic disorders in a Chinese Han population PMID: 23747398
  • Cathepsin S activity appears to be involved in the early dysregulation of glucose and insulin metabolism. PMID: 22923671
  • Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners PMID: 22952693
  • The present study was designed to determine the role of Cat S in human hepatocellular carcinoma cell growth, invasion and angiogenesis, using RNA interference technology. PMID: 22796222
  • CTSS variants seem to be nominally associated to obesity related traits and this association may be modified by dietary protein intake PMID: 22844403
  • HCV has an inhibitory role on cathepsin S-mediated major histocompatibility complex (MHC) class II maturation, which may contribute to weak immunogenicity of viral antigens in chronic infections. PMID: 22761382
  • Cathepsin S therefore appears to be an important factor that influences selection of autoreactive T cells. PMID: 22424724
  • Cathepsin S specificity profile appears to be pH-independent. PMID: 21967108
  • Cathepsin S plays an important role in the regulation of cell autophagy through interference with the EGFR-ERK/MAPK-signaling pathway. PMID: 22101325
  • results signify that CatS may be an important prognostic biomarker and predictive of response to adjuvant fluoruracil/folinic acid in colorectal carcinoma PMID: 21989182
  • The cathepsin S deserves further evaluation as therapeutic targets to develop disease modifying drugs to treat Alzheimer's disease. PMID: 21585286
  • Serum cathepsin S showed significantly lower values 4 days after surgery PMID: 21250859
  • Among elderly individuals in 2 independent cohorts, higher serum cathepsin S levels were associated with increased mortality risk PMID: 21878432
  • results suggest that CTSS mediated atherogenesis may be associated with a CD40 mediated inflammatory and immune response. Further invasive atheroma analysis is reasonable PMID: 21223957
  • Cathepsin S activity in human whole blood was dependent on the time of blood collection, suggesting that cathepsin S activity is subject to circadian variations. PMID: 21094118
  • Our data provide first evidence that Cathepsin S expression is selectively induced in psoriatic keratinocytes. PMID: 19849712
  • Down-regulation of cathepsin S was found in inverted papilloma tissues as compared with its expression level in normal sinus mucosa tissues. PMID: 21038029
  • the immunosuppressive effects of IL-10-STAT3 on MHC-II antigen presentation may occur via the inhibition of cathepsin S expres PMID: 20356901
  • The researchers found no evidence of an association between the CTSS -25G/A polymorphism and the presence of coronary artery disease in a Chinese population. PMID: 19593952
  • cathepsin S was found to be significantly elevated in rheumatoid arthritis and osteoarthritis synovial fluid. PMID: 20180636
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed