Recombinant Human Cathepsin O (CTSO) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02861P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cathepsin O (CTSO) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02861P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cathepsin O (CTSO) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P43234 |
Target Symbol | CTSO |
Synonyms | Cathepsin O; CATO_HUMAN; Ctso; CTSO1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV |
Expression Range | 108-321aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.5 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. |
Subcellular Location | Lysosome. |
Protein Families | Peptidase C1 family |
Database References | |
Tissue Specificity | Expressed in all tissues examined. High levels seen in the ovary, kidney and placenta while low levels seen in thymus and skeletal muscle. |
Gene Functions References
- We report that CTSO reduces the protein levels of BRCA1 and ZNF423 through cysteine proteinase-mediated degradation. We also have identified a series of transcription factors of BRCA1 that are regulated by CTSO at the protein level. PMID: 28968398
- a single-nucleotide polymorphism near the CTSO gene is a poor prognostic factor in breast cancer although further research might help to reveal the factors linking this genotype and prognosis. PMID: 26482374