Recombinant Human Cathepsin B (CTSB) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05696P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Cathepsin B (CTSB) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05696P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Cathepsin B (CTSB) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Specific activity as determined by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC is greater than 3000 pmol/min/ug |
| Uniprotkb | P07858 |
| Target Symbol | CTSB |
| Synonyms | Amyloid precursor protein secretase; APP secretase; APPS; CATB_HUMAN; Cathepsin B heavy chain; Cathepsin B1; CathepsinB; CPSB; CTSB; cysteine protease; OTTHUMP00000116009; OTTHUMP00000229510; OTTHUMP00000229511; OTTHUMP00000229512; OTTHUMP00000229514; OTTHUMP00000229515; OTTHUMP00000229516; Preprocathepsin B |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |
| Expression Range | 18-339aa |
| Protein Length | Partial |
| Mol. Weight | 36.9 kDa |
| Research Area | Cancer |
| Form | Liquid |
| Buffer | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis. |
| Subcellular Location | Lysosome. Melanosome. Secreted, extracellular space. Apical cell membrane; Peripheral membrane protein; Extracellular side. |
| Protein Families | Peptidase C1 family |
| Database References | HGNC: 2527 OMIM: 116810 KEGG: hsa:1508 STRING: 9606.ENSP00000342070 UniGene: PMID: 29935187 |
