Recombinant Human Cathepsin B/CTSB Protein

Name: Recombinant Human Cathepsin B/CTSB Protein
Brand: Beta LifeScience
SKU: BLA-3044P
Availability: InStock

Collections: All products, Explore high-quality enzymes for research and supplementation, High-quality recombinant proteins, Protease

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P07858
Synonym	Amyloid precursor protein secretase APP secretase APPS CATB_HUMAN Cathepsin B heavy chain Cathepsin B1 CathepsinB CPSB CTSB cysteine protease OTTHUMP00000116009 OTTHUMP00000229510 OTTHUMP00000229511 OTTHUMP00000229512 OTTHUMP00000229514 OTTHUMP00000229515 OTTHUMP00000229516 Preprocathepsin B
Description	Recombinant Human Cathepsin B/CTSB Protein was expressed in HEK293. It is a Full length protein
Source	HEK293
AA Sequence	MPLLLLLPLLWAGALARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVD MSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRD QGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCN GGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGE GDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEG AFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWN TDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Molecular Weight	43 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Specific Activity: -‰¥ 4048 pmol/min/µgAssay condition: 25 mM MES, pH 5.0, 10 μM substrate (Z-Leu-Arg-AMC), 10 min, room temperature. Prior to assay enzyme was activated with preincubation at 10 μg/ml in 25 mM MES, pH 5.0, 5 mM DTT for 15 min at RT.
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis.
Subcellular Location	Lysosome. Melanosome. Secreted, extracellular space. Apical cell membrane; Peripheral membrane protein; Extracellular side.
Protein Families	Peptidase C1 family
Database References	HGNC: 2527 OMIM: 116810 KEGG: hsa:1508 STRING: 9606.ENSP00000342070 UniGene: PMID: 29935187 expression of cathepsin B and X was detected in stromal cells and cancer cells throughout the glioblastoma (GBM) sections, whereas cathepsin K expression was more restricted to arteriole-rich regions in the GBM sections. Metabolic mapping showed that cathepsin B, but not cathepsin K is active in GSC niches. PMID: 30046941 we evaluated the involvement of cathepsin B and X in the TGF-b1 signaling pathway, one of the key signaling mechanisms triggering epithelial-mesenchymal transition in cancer. In MCF-7 cells the expression of cathepsin B was shown to depend on their activation with TGF-b1 while, for cathepsin X, a TGF-b1 independent mechanism of induction during EMT is indicated. PMID: 28495172 these data suggest that apoptosis is induced by increasing lysosomal membrane permeability and leakage of CTSB into cytoplasm. PMID: 28478025 These findings indicate that Cathepsin B (CTSB), may be an important prognostic biomarker for late stage colorectal cancer (CRC)and cases with lymph node metastases in the Middle Eastern population. Monitoring serum CTSB in CRC patients may predict and/or diagnose cases with lymph node metastases. PMID: 28440429 Findings from this community-based cohort of young children show that surrogate markers for cardiovascular disease such as total fat mass, percent body fat, abdominal fat, body fat distribution, maximal oxygen uptake and pulse pressure were all associated with cystatin B. This was not found for cathepsin L or cathepsin D PMID: 29149174 Interruption of either CCL2-CCR2 signaling or cathepsin B function significantly impaired perineural invasion (PNI). PMID: 28951461 Data suggest that expression of CTSB in human glioblastoma cell line can be modulated by dietary factors; here, caffeine decreases tumor size and CTSB expression in mouse xenograft model of glioblastoma; note that caffeine, normally a dietary component, was administered via intraperitoneal injection in these studies. PMID: 27260469 SNPs in NLRP3 and CTSB, associated with an increased NLRP3-inflammasome activation, are protective against the development of active pulmonary tuberculosis. PMID: 27101784 cathepsin B activity assays identified secreted cathepsin B as responsible for apoA-I cleavage at Ser(228) Importantly PMID: 27630170 ctsB enhanced neutrophil migration though a putative effect on pseudopod retraction rates. PMID: 28389621 We have shown that keratolytic winter erythema in South African and Norwegian families is caused by two different tandem duplications in a non-coding genomic region upstream of CTSB. PMID: 28457472 CtsB/L as major regulators of lysosomal function and demonstrate that CtsB/L may play an important role in intracellular cholesterol trafficking and in degradation of the key AD proteins PMID: 27902765 in CTSB knockout (KO) mice, running did not enhance adult hippocampal neurogenesis and spatial memory function. Interestingly, in Rhesus monkeys and humans, treadmill exercise elevated CTSB in plasma. PMID: 27345423 Report non-proteolytic cathepsin B functiona in tumor cell lines. PMID: 27526672 cathepsin B (CTSB) inhibition or expression of a CTSB-resistant Dab2 mutant maintains Dab2 expression and shifts long-term TGF-beta-treated cells from autophagy to apoptosis PMID: 27398911 cathepsin L and cathepsin B as the lysosomal cysteine proteases that activate the PEDV spike. PMID: 27729455 Results showed an increase level of CTSL, and CTSB in dilated cardiomyopathy patients which correlates with reduced left ventricular ejection fraction. PMID: 28074340 Gene expression level of genes of CTSB is significantly higher in AD patients when compared to normal controls. PMID: 26943237 Serum CTSB and CTSD concentrations were found to have a diagnostic value in NPC. However, the CTSB and CTSD serum levels had no prognostic role for the outcome in nasopharyngeal carcinoma patients. PMID: 26995190 CTSB might be involved in the development and progression of hepatocellular carcinoma. PMID: 26896959 Cathepsin B knockdown in oral cancer cells reduces cell migration. PMID: 27031837 the authors applied the technique of nanoelectrode arrays to try to detect and compare cathepsin B activities in normal and breast cancer cells. It was found that protease activity correlated positively with the degree of malignancy cancer cells. PMID: 25959927 shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity. PMID: 26081835 High cathepsin is associated with drug resistance in neuroblastoma. PMID: 25883214 The expressions of cathepsin B strongly correlated with the Mini-Mental State Examination scores of the Alzheimer disease. patients PMID: 25502766 Integrin alphavbeta3 is required for cathepsin B-induced hepatocellular carcinoma progression PMID: 25572981 The serum level of cathepsin L decreased with age, while cathepsin B remained no significant difference between young and aged individuals PMID: 25991043 Cathepsins B and L activity correlates with the efficiency of reovirus-mediated tumor cell killing. PMID: 25633482 enhanced activity and expression of cathepsin B contributes to an increased remodelling of extracellular matrix that favours leiomyoma growth PMID: 25577554 SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification. PMID: 25802234 data suggest that CTSB is a pathophysiologically relevant protease that activates ENaC in cystic fibrosis airways PMID: 25260629 Cathepsin B activity is increased in blood and CSF from HIV-infected cocaine users. PMID: 25209871 CB was highly upregulated in human ESCC and its precursor lesions. The elevated CB expression in ESCC allowed in vivo and in vitro detection of ESCC xenografts in nude mice. PMID: 24618814 Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B PMID: 25452305 A4383C and C76G SNP in Cathepsin B is respectively associated with the high risk and tumor size of hepatocarcinoma. PMID: 25106406 Overexpression of uPAR and cathepsin B increases expression of cytosolic p-JNK. PMID: 24699410 Study shows that CTSB overexpression in the cancer cells increases growth of invasive ductal carcinoma in the MMTV-PyMT mouse model of breast cancer. PMID: 24077280 Cathepsin B (CB) substantially contributes to the invasive phenotype of FLS that leads to joint destruction in RA. PMID: 24749816 Cathepsin D and B activities in the serum of patients with urothelial bladder cancer are directly proportional to disease severity and significantly higher compared with control group. PMID: 25095637 Cathepsin B produces full-length amyloid-beta (Ab(1-40/42)) and pyroglutamate amyloid-beta (pyroGluAb(3-40/42) and is a key drug target for treating Alzheimer's disease by reducing these amyloid-beta species PMID: 24595198 Cathepsin B is a key drug target for reducing the brain damage and improving neuromuscular dysfunction resulting from traumatic brain injury (TBI). PMID: 24083575 Correlation between higher CTSB expression and lower survival rate in human lung squamous cell carcinoma. PMID: 24139065 archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo. PMID: 24166050 These observations point to a critical regulatory role for that endogenous CD activity in dopaminergic cells in alpha-synuclein homeostasis which cannot be compensated for by increased Cathepsin B. PMID: 24138030 Data indicate that wild type and mutant amyloid precursor proteins (APP) expression enhances the induction in cathepsin B after administration of proteasome inhibitor MG132. PMID: 24215712 Data suggest that CTSB (cathepsin B) and CTSL (cathepsin L) of the autophagic-lysosomal proteolytic system are involved as the main proteolytic system in skeletal muscle during cancer cachexia development in patients with esophageal cancer. PMID: 24108784 Depletion of Cathepsin B in vitro inhibited cell proliferation. PMID: 23708264 Increased concentrations of cathepsins B, D and G in the proliferative eutopic endometrium may play a role in the implantation of endometrial tissue outside the uterine cavity. PMID: 23466190 High cathepsin expression is associated with dysplasia and colitis-associated cancer. PMID: 23591598

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.