Recombinant Human Caspase-14 (CASP14) Protein (GST)

Name: Recombinant Human Caspase-14 (CASP14) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08567P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Caspase-14 (CASP14) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31944
Target Symbol	CASP14
Synonyms	Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
Expression Range	153-240aa
Protein Length	Full Length of Mature Protein
Mol. Weight	37.2kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum. Seems to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin. In vitro has a preference for the substrate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF. Involved in processing of prosaposin in the epidermis. May be involved in retinal pigment epithelium cell barrier function. Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	Peptidase C14A family
Database References	HGNC: 1502 OMIM: 605848 KEGG: hsa:23581 STRING: 9606.ENSP00000221740 UniGene: PMID: 28570747 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14 PMID: 25651379 caspase-14 contributes to retinal pigment epithelium cell barrier disruption under hyperglycemic conditions. PMID: 25121097 Caspase-14 was decreased in inflammatory lesions compared to non-lesion in atopic dermatitis. The amount of caspase-14 in the lesions correlated with clinical severity as determined by eczema area and severity index score and the skin barrier functions. PMID: 25315296 Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models. PMID: 24872419 partial loss of caspase 14 is not associated with dedifferentiation in neoplastic lesions of the oral mucosa PMID: 23645350 genetic polymorphisms in AICDA and CASP14 are associated with risk for brain tumor in Korean children. PMID: 23408445 Suggest caspase-14 is a marker of human skin differentiation during development. PMID: 23377137 Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development. PMID: 23580611 ceramides, an important structural lipid, stimulate caspase-14 expression, coordinating formation of lipid lamellar membranes with the formation of corneocytes PMID: 23362869 Caspase-14 might play a significant role in the pathogenesis of diabetic retinopathy by accelerating retinal endothelial and epithelial cells death. PMID: 22876114 regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14. PMID: 22825846 genetic polynorphism is associated with the risk of childhood leukemia PMID: 22548721 A strong association was evident between GATA-3 and caspase-14 expression in preinvasive ductal carcinoma in situ samples, where GATA-3 also displayed prognostic significance PMID: 21930782 Regulation of caspase 14 levels provides a possible link between impaired skin barrier function and inflammatory reactions in skin diseases such as atopic dermatitis and may offer an explanation to the skin barrier dysfunction in inflamed skin lesions. PMID: 21539619 Casp-14 overexpression correlated with tumor stage, cell differentiation and lymphovascular involvement, suggesting that casp-14 was associated with tumor cell growth and metastatic potential. PMID: 21567094 Caspase 14 is a cysteine protease and is inhibited by full-length LEKTI and 5 recombinant fragments of LEKTI to varied extents. PMID: 20533828 Purification and characterization of active caspase-14 from human epidermis and development of the cleavage site-directed antibody PMID: 19960512 Results imply that caspase-14 inhibits trophoblast differentiation. PMID: 19747408 processing of caspase 14 in epidermal differentiation PMID: 12200134 caspase-14, similarly to other keratinocyte differentiation-associated proteins, is downregulated by retinoids, suggesting that this caspase plays a part in terminal keratinocyte differentiation and skin barrier formation PMID: 12445205 Loss of caspase-14 expression is associated with psoriatic lesions PMID: 15331408 psoriatic keratinocytes may activate mechanisms that prevent the nuclear entry of caspase 14 PMID: 15619438 caspase-14 is aberrantly expressed in epithelial tumors PMID: 16061209 there are tumor-specific alterations in caspase-14 expression which may define subsets of epithelial cancers with distinct clinical behaviors PMID: 16061862 Caspase-14 is present in the human placenta, primarily in the trophoblast, but its function is not clear PMID: 16168224 caspase-14 has a substrate specificity similar to the group I caspases, and demonstrate that it functions in a distinct manner from executioner caspases to carry out specific proteolytic events during keratinocyte differentiation. PMID: 16854378 caspase-14 is up-regulated during trophoblast differentiation, as represented by the BeWo cell line PMID: 17359582 Expression of exogenous caspase-14 led to growth inhibition and reduced the tumorigenicity of A431 skin cancer cells. PMID: 17436577 caspase-14 gene is rarely mutated in colorectal carcinomas, but not mutated in gastric, lung, breast and hepatocellular carcinomas PMID: 17558860 These data reveal the basic organization of the human caspase-14 promoter and suggest an important role of AP-1 and NFkappaB in the transcriptional control of caspase-14. PMID: 18424262 Expression of caspase 6 and caspase 14 genes were different between normal skin of keloid-prone individuals and normal skin of keloid-resistant patients. PMID: 18762957

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.