Recombinant Human Caspase-1 (CASP1) Protein (HA)

Name: Recombinant Human Caspase-1 (CASP1) Protein (HA)
Brand: Beta LifeScience
SKU: BLC-00920P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Caspase-1 (CASP1) Protein (HA) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P29466
Target Symbol	CASP1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-HA
Target Protein Sequence	MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA
Expression Range	1-91aa
Protein Length	Partial
Mol. Weight	11.4 kDa
Research Area	Apoptosis
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides. Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a proinflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes. Cleaves a tetrapeptide after an Asp residue at position P1. Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD. In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.; Apoptosis inactive.; Apoptosis inactive.
Subcellular Location	Cytoplasm. Cell membrane.
Protein Families	Peptidase C14A family
Database References	HGNC: 1499 OMIM: 147678 KEGG: hsa:834 STRING: 9606.ENSP00000410076 UniGene: PMID: 29957081 Cryo-EM structures of ASC and NLRC4 CARD filaments reveal a unified mechanism of nucleation and activation of caspase-1 PMID: 30279182 The increased expression of NLRP3 and caspase-1 in fetal membrane and placental tissues may be associated with the development of premature rupture of membrane. PMID: 29545514 inflammasome activation and pyroptosis in human microglia and ODCs in vitro after exposure to inflammatory stimuli and demonstrate caspase-1 inhibition by the small-molecule inhibitor VX-765 in both cell types. GSDMD inhibition by siRNA transduction suppressed pyroptosis in human microglia. PMID: 29895691 Increased production of caspase-1 in the gut-associated lymphoid tissue and peripheral blood of HIV infected patients. PMID: 29672590 Low CASP1 expression is associated with prostate cancer. PMID: 28388569 These findings confirm the involvement of caspase-1 in non-classical secretion mechanisms and open novel perspectives for the extracellular function of secreted GBP-1. PMID: 28272793 this study demonstrates that the G+7/in6A and A10370-G polymorphisms of the CASP1 gene are associated with increased risk of developing acute coronary syndrome in Mexican population PMID: 28456882 After genotype calling and quality control filtering with exclusion of 3 cases and 3 controls, association analysis was performed across 76 directly genotyped SNPs in NLRP1, CARD, and CASP1 genes, adjusting for age, sex, and population stratification PMID: 29438387 Caspase-1 role in pyroptosis in glioma cells.Mir-214 regulates caspase-1 expression in glioma. PMID: 28244850 Data show that cyclic stretch activated the nucleotide-binding oligomerization domain-like receptor containing pyrin domain 1 and 3 (NLRP1 and NLRP3) inflammasomes and induced the release of IL-1beta and pyroptosis via a caspase-1-related mechanism in human periodontal ligament cells (HPDLCs). PMID: 27626170 Caspase-1 directly cleaves alpha-Synuclein, generating a highly aggregation-prone species in neurons. PMID: 27482083 the activation of Rho GTPases by the CNF1 toxin during E. coli-triggered bacteremia leads to a GR1(+)cell-mediated efficient bacterial clearing and improves host survival. Host alarm requires the Caspase-1/IL-1beta signaling axis. PMID: 26492464 Nodakenin inhibited the mRNA expression and production of pro-inflammatory cytokines and caspase-1 activation PMID: 28407357 sickle red blood cell induced TLR9, NLRP3, Caspase-1, IL-1beta and IL-18 expression and induced IL-1beta, LTB4 and nitrite production in PBMC cultures. PMID: 27045344 Data show that the serine protease inhibitor B9 (serpinB9) mediated caspase-1 inhibition regulates IL-1beta release in monocytes. PMID: 26992230 study uncovers a novel mechanism of G9A promoting tumor cell growth and invasion by silencing CASP1, and implies that G9A may serve as a therapeutic target in treating Non-small-cell lung cancer. PMID: 28383547 Caspase-1 polymorphisms may play a role in Chagas cardiomyopathy development and could serve as markers to identify individuals at higher risk for priority treatment. PMID: 28954073 besides its role in the inhibition of the NF-kappaB pathway, NLRC3 interferes with the assembly and activity of the NALP3 inflammasome complex by competing with ASC for pro-caspase-1 binding PMID: 28584053 Data, including data from studies using recombinant fusion forms of GSDMD (gasdermin D), suggest that GSDMD participates in inflammasome-dependent pyroptosis of macrophages in response to various stimuli; this mechanism involves proteolysis of GSDMD by caspase-1 and caspase-11. PMID: 28726636 Proteases caspase-1 and caspase-8 have redundant roles in cleaving IL-1beta and promoting osteomyelitis. [review] PMID: 27148834 Patients with NLRP1-associated autoinflammation with arthritis and dyskeratosis syndrome had increased systemic CASP1. PMID: 27965258 The biochemical function of NLPR3 inflammasomes is to activate caspase-1, which leads to the maturation of interleukin 1 beta and IL-18 and the induction of pyroptosis, a form of cell death. (Review) PMID: 27669650 The structure of the human caspase-1 CARD domain (caspase-1(CARD)) filament solved by cryo-electron microscopy. PMID: 27043298 Caspase-1-mediated downregulation of PPARgamma was important in the late stage of monocyte-macrophage differentiation; however, PPARgamma protein levels had little effect on the early stage differentiation. PMID: 28052562 Inflammasome NLRP3-caspase-1-mediated degradation of smooth muscle cell contractile proteins may contribute to aortic biomechanical dysfunction and aortic aneurysm/dissection development. PMID: 28153878 Study demonstrates that the expression of the NLRP3-caspase-1-IL-18 axis is highly expressed in the peripheral blood mononuclear cells of patients with bullous pemphigoid (BP), and correlated with disease activity, suggesting its involvement in the pathogenesis and progression of BP. PMID: 27174093 High expression of CASP1 is associated with osteosarcoma. PMID: 28000894 This study demonstrated that dysregulated expression of NLRP3-caspase-1-IL-1beta axis was observed in patients with MM, suggesting they might be involved in the pathogenesis of MM. PMID: 26146985 The NLRP3/caspase-1/IL-1beta axis is active in cartilaginous endplates of patients with Modic changes and inflammatory cascades can exacerbate the cartilaginous endplate degeneration which may act as a trigger for intervertebral disc degeneration and low back pain. PMID: 27146654 High expression of NLRP3, NLRC4, and CASP1 in background non-tumorous liver is significantly correlated with poor prognosis of patients after resection of hepatocellular carcinoma. PMID: 28011505 The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media. PMID: 26457439 The results indicate that acteoside may act as a regulator of the IL-32 induced immune responses. PMID: 26453510 These results suggest that released caspase-1 exists in a unique complex that is functionally stable and protected from immunodepletion whereas cell-extract generated active caspase-1 is rapidly inhibited in the cytosolic milieu. PMID: 26599267 Genetic polymorphisms in Nalp3 and caspase-1 may be associated with individual susceptibility to silicosis, especially when the polymorphisms interact with age, cumulative dust exposure, or smoking status. PMID: 26496436 In contrast, inhibition of the protease activity of Kgp, RgpA or RgpB increased the human caspase-1-activating potential of wild-type Porphyromonas gingivalis, indicating an inhibitory effect of the collaborative action of gingipains. PMID: 25759090 NLRP3 and caspase-1 are expressed in the odontoblast layers in normal human dental pulp tissue, whereas in inflamed pulp tissue, the odontoblast layers are disrupted and dental pulp cells are positive for NLRP3 and caspase-1. PMID: 25684031 the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation PMID: 26240347 specific caspase cleavage sites in Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome PMID: 26218605 three cofactor independent human monoclonal aPL can induce transcription of NLRP3 and caspase-1 resulting in inflammasome activation specific for NLRP3, which depends fully on activation of endosomal NADPH-oxidase-2 (NOX2) by aPL PMID: 25589411 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes. PMID: 26466953 In patients with HIV, serum CASP1 levels in a group with high CD4 cell counts increased rapidly then decreased within a short time during early HIV-1 infection. In contrast, CASP1 levels in the CD4Low group were increased after 1 year of HIV-1 infection. PMID: 25806508 production of 20-kDa IL-1beta may act to limitIL-1beta signaling by reducing the pool of pro-IL-1beta availability for caspase-1 cleavage PMID: 26324708 The study shows that A1AT does not inhibit human monocyte caspase-1. PMID: 25658455 Data suggest activation of CASP1 (caspase-1) and secretion of IL18 (interleukin 18)/IFNG (interferon-gamma) in mucosal explants of ileum/colon are related to intensity of inflammatory lesions in patients with active, long-standing Crohn's disease. PMID: 26168332 Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2 PMID: 26324711 the inflammatory CASP1 is linked to several genes involved in cholesterol homeostasis. These correlations resulted in altered GBM (Glioblastoma Multiforme), in particular for CASP1 PMID: 25330190 caspase 1 was higher in degenerated intervertebral discs than in healthy controls. PMID: 25284686 ASC interacts with NALP3 and caspase-1 via different domains. PMID: 25567507 Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever. PMID: 26510601

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.