Recombinant Human Casein Kinase Ii Subunit Beta (CSNK2B) Protein (GST)

Name: Recombinant Human Casein Kinase Ii Subunit Beta (CSNK2B) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08502P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Casein Kinase Ii Subunit Beta (CSNK2B) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P67870
Target Symbol	CSNK2B
Synonyms	Casein kinase 2 beta polypeptide; Casein kinase II beta subunit; Casein kinase II subunit beta; CK II beta; CK2B; CK2N; CSK2B; CSK2B_HUMAN; CSNK 2B; csnk2b; G5A; MGC138222; MGC138224; Phosvitin; Protein G5a
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Expression Range	2-215aa
Protein Length	Partial
Mol. Weight	51.8kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Participates in Wnt signaling.
Protein Families	Casein kinase 2 subunit beta family
Database References	HGNC: 2460 OMIM: 115441 KEGG: hsa:1460 STRING: 9606.ENSP00000365025 UniGene: PMID: 28585349 ALMS1, GLT8D1, and CSNK2B are schizophrenia risk genes. PMID: 29483533 We report interactions between CSNK-2beta and IGFBP-1 as well as mTOR and CSNK-2beta, providing strong evidence of a mechanistic link between mTOR and IGF-I signaling, two critical regulators of cell growth via CSNK-2. PMID: 29037858 Casein kinase 2 role in the proliferation of human osteosarcoma cells. PMID: 27959425 Data suggest that cryptochromes (Cry1 and Cry2) mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). PMID: 26562092 AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury. PMID: 26108355 ARKL1 binds CK2beta through the KSSR motif and this involves a polyserine sequence resembling the CK2beta binding sequence in EBNA1. PMID: 24216761 The high expression of protein kinase CK2beta is closely related to the carcinogenesis and malignancy of esophageal cancer. PMID: 23076192 The high expression of ck2beta in colorectal cancer is closely correlated to carcinogenesis and metastasis. PMID: 21515457 A dysregulation of CK2beta expression might contribute to epithelial-to-mesenchymal-transition induction during cancer progression. PMID: 21755461 C-terminal domain of PLD2 can regulate CKII by accelerating CKIIbeta degradation in HCT116 cells PMID: 21944249 Our findings argue against the hypothesis that genetic variability in the G-Protein-Coupled Receptor Kinase 5 and Casein Kinase 2 genes modifies Parkinson disease susceptibility PMID: 21514207 CK2 enhances the protein level and activity of TTP via the modulation of the MKP-1-p38 MAPK signaling pathway; TGF-beta1 enhances the activity of CK2 PMID: 21507959 Identification of key residues on CK2alpha and CK2beta that play a cooperative role in CK2alpha/CK2beta binding and thermodynamics is important to further understand how these subunits interact in order to form a tetramer. PMID: 21142136 Threonine at amino acid (aa) 770 and serine at aa 854 to 855 of RIG-I are phosphorylated by casein kinase II (CK2) in the resting state of the cell and dephosphorylated when cells are infected by RNA virus. PMID: 21068236 analysis of interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2 PMID: 20372791 Freshly isolated peripheral blood mononuclear cells from patients with chronic lymphocytic leukemia (n = 44) showed significantly higher levels of phosphorylated Akt1,PTEN, and casein kinase 2 than healthy persons (n = 8). PMID: 20576813 CK2 could phosphorylate TNFAIP1 in vitro and in vivo, which facilitated the distribution of TNFAIP1 in nucleus and enhanced its interaction with PCNA. PMID: 19851886 The Casein Kinase 2 (CK2) was identified as a binding and regulatory partner for Mitogen- and stress-activated protein kinase(MSK1). PMID: 20044958 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins. PMID: 11710515 Protein kinase CK2 dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TRCp and enhances beta-catenin degradation. PMID: 12037680 sequencing of full-length DNA encoding subunits in platelets and megakaryocytic cells PMID: 12102635 FGF-1 binds to both the catalytic alpha-subunit & to the regulatory beta-subunit of CK2.The presence of FGF-1 or FGF-2 was found to enhance the autophosphorylation of CK2 beta. PMID: 12145206 results show that the Ring-H2 finger motif of CKBBP1 is necessary for efficient binding to CKIIbeta, as well as for optimal cell proliferation PMID: 12470599 microtubule-associated protein that confers microtubule stability in a phosphorylation-independent manner PMID: 14634006 Casein kinase II (CKII) phosphorylates synphilin-1; beta subunit of this enzyme complex binds to synphilin-1. CKII-mediated phosphorylation of synphilin-1, rather than alpha-synuclein, modulates the aggregation into inclusion bodies. PMID: 14645218 CK2 phosphorylation of La can affect production of the translational machinery PMID: 15485924 These findings support the notion that CK2beta can act as a general modulator of remote docking sites in protein kinase--substrate interactions. PMID: 15940255 there is a functional link between S6K1 II and CK2 signaling, which involves the regulation of S6K1 II nuclear export by CK2-mediated phosphorylation of Ser-17 PMID: 16895915 hNopp140 serves as a negative regulator of CK2 and InsP(6) stimulates the activity of CK2 by blocking the interaction between hNopp140 and CK2 PMID: 17038328 a stabilized form of CK2beta can be used to inhibit cell proliferation PMID: 17681943 protein kinase CK2 is involved in cell cycle regulation and indicate the mechanism by which CDC25A turnover might be regulated by Chk1 in the absence of DNA damage. PMID: 17912454 Further studies in transgenic mice and cultured cells suggest that cellular toxicity, including proteasomal dysfunction, increases casein kinase 2 activity, which results in elevated Ser129 alpha-syn phosphorylation. PMID: 18451726 The regulatory beta-subunit of protein kinase CK2 regulates cell-cycle progression. PMID: 18469858 These findings support the view that CK2beta regulates various intracellular processes by modulating the activity of protein kinases that are distinct from CK2. PMID: 18560763 Data show that these CK2-targeted motifs in MDC1 are required to mediate NBS1 association with chromatin-flanking sites of unrepaired DNA double-strand breaks. PMID: 18583988 In epithelial cells, a fraction of CK2 is associated to the plasma membrane and that this localization is controlled by cell-matrix interactions. PMID: 18587631 presents unbound three-dimensional structure of a CK2beta construct that is fully capable of CK2alpha recruitment and quantify its affinity to CK2alpha thermodynamically PMID: 18824508 CK2beta is widely expressed in endometrial carcinoma , and suggest a role in cell proliferation and anchorage-independent cell growth PMID: 19056846 Casein kinase 2 phosphorylates human cytomegalovirus pUL84, and this interaction is required for oriLyt-dependent DNA replication. PMID: 19091862 These studies support CK2beta as an important regulator of ALK-1 signaling and ALK-1-mediated functions in endothelial cells. PMID: 19592636 These experiments indicate that casein kinase II phosphorylation of varicella-zoster virus open reading frame 63 S186 occurs in the nucleus and possibly identify an initial molecular event operative in virus reactivation. PMID: 19759161

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.