Recombinant Human Cardiac Troponin I / TNNI3 Protein
Beta LifeScience
SKU/CAT #: BLA-12616P
Recombinant Human Cardiac Troponin I / TNNI3 Protein
Beta LifeScience
SKU/CAT #: BLA-12616P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P19429 |
Synonym | cardiac muscle Cardiac troponin I cardiomyopathy, dilated 2A (autosomal recessive) Cardiomyopathy, familial hypertrophic, 7, included CMD1FF CMD2A CMH7 cTnI Familial hypertrophic cardiomyopathy 7 MGC116817 RCM1 Tn1 Tni TNN I3 TNNC 1 TNNC1 TNNI3 TNNI3_HUMAN Troponin I Troponin I cardiac Troponin I cardiac muscle Troponin I cardiac muscle isoform Troponin I type 3 cardiac troponin I, cardiac 3 TroponinI Ttroponin I type 3 (cardiac) |
Description | Recombinant Human Cardiac Troponin I / TNNI3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKT LLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLH ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISA DAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGM EGRKKKFES |
Molecular Weight | 24 kDa |
Purity | > 95% Ion Exchange Chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |