Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein (His)

Name: Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07868P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, High-quality recombinant proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P06731
Target Symbol	CEACAM5
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Expression Range	35-685aa(E398K)
Protein Length	Full Length of Mature Protein
Mol. Weight	73.3 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.; (Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane. Cell surface.
Protein Families	Immunoglobulin superfamily, CEA family
Database References	HGNC: 1817 OMIM: 114890 KEGG: hsa:1048 STRING: 9606.ENSP00000221992 UniGene: PMID: 28291565 High carcinoembryonic antigen elevation is associated with recurrence in rectal cancer. PMID: 29774483 CEA and CA19-9 are cancer antigens that are late markers of carcinogenesis, with significantly elevated serum concentrations in case of colon cancer with already developed metastases. Older age group of patient has significantly elevated levels of both antigens. Cancer was twice more common in men than in women. PMID: 25568506 High CEA expression is associated with breast cancer metastasis. PMID: 29433529 Pretreatment serum CEA levels over 30.02 ng/mL on behalf of worse characteristics and unfavourable tumor behavior, and a poor prognosis for a nearly doubled risk of mortality in gastric cancer patients. PMID: 29358864 Elevation of CEA level was an independent risk factor for the poor prognosis of early gastric cancer. PMID: 29121872 The elevation of serum CEA level was independent from the other tumor markers in hypohidrotic condition represented by acquired idiopathic generalized anhidrosis. PMID: 28295553 Elevated CEA levels during targeted therapy may be a more sensitive predictor of explosive lung adenocarcinoma progression in patients harboring mutant EGFRs compared to traditional imaging methods. PMID: 28705152 Increased CEA expression is associated with colorectal cancer. PMID: 28128739 The detection of TK1 combined with that of cytokeratin-19 fragment (CYFRA21-1), CEA or NSE increased the diagnostic value of TK1 for lung squamous cell carcinoma, adenocarcinoma and small cell lung cancer, respectively. PMID: 29247745 In patients with non-small-cell lung cancer treated with nivolumab, worse pretreatment performance status, and higher carcinoembryonic antigen were associated with inferior progression-free survival. PMID: 29277824 To examine the relation of carcinoembryonic antigen (CEA) response with tumor response and survival in patients with (K)RAS wild-type metastatic colorectal cancer receiving first-line chemotherapy in the FIRE-3 trial comparing FOLFIRI plus cetuximab versus FOLFIRI plus bevacizumab PMID: 27234640 This is the first population-based investigation of a large cohort of exclusively stage I rectal cancer patients providing compelling evidence that elevated preoperative CEA level is a strong predictor of worse overall and cancer-specific survival. PMID: 27067235 Elevated levels of systemic IFNgamma and IL-6 implied that the CEACAM5-specific T cells had undergone immune activation in vivo but only in patients receiving high-intensity pre-conditioning. PMID: 28660319 Combination of the two tumor markers, CEA and CYFRA21-1, is a predictive and prognostic marker of docetaxel monotherapy for previously treated NSCLC patients PMID: 28870944 Patients with CEA-High stage I NSCLC have a higher risk of regional or systemic relapse and should be followed-up carefully. PMID: 28870949 Postoperative CEA level >2.5 ng/ml is a predictor of distant metastasis and a negative prognostic factor for survival in rectal cancer patients who receive preoperative chemoradiotherapy and curative surgery. PMID: 27553616 Data show that triple-negative breast cancer (TNBC) patients with pre-therapeutic serum high levels of both carcinoembryonic antigen (CEA) and cancer antigen 15-3 (CA15-3) had shorter overall survival (OS) and disease-free survival (DFS) rates than those in the low-level groups. PMID: 27561099 Serum CEA level is not influenced by the presence of benign dominant biliary stricture or superimposed bacterial cholangitis in patients with primary sclerosing cholangitis. PMID: 27943017 Preoperative-CEA was elevated (>/=5.0 ng/mL) in 73.6% of the colorectal cancer patients and remained elevated after surgery in 32.7% of the patients. Elevated postoperative-CA 19-9 (>/=50 U/mL) was observed in 9.5% of the patients. Neither elevated pre-CEA nor elevated pre-CA 19-9 was associated with relapse-free survival (RFS) but both elevated post-CEA and elevated post-CA 19-9 were associated with reduced RFS. PMID: 27664887 the diagnostic sensitivity and specificity of serum reactive oxygen species modulator 1 were only 41.38% and 86.21%, respectively, with the cutoff value of 27.22 ng/mL. The sensitivity and specificity of pleural fluid carcinoembryonic antigen were 69.23% and 88.00%, respectively, at the cutoff value of 3.05 ng/mL, while serum carcinoembryonic antigen were 80.77% and 72.00% at the cutoff value of 2.60 ng/mL. PMID: 28459208 Taken together, the results of our study identified CEACAM5 as a novel cell surface binding target of Middle East respiratory syndrome coronavirus that facilitates infection by augmenting the attachment of the virus to the host cell surface. PMID: 27489282 Data show that carcinoembryonic antigen (CEA) modestly differentiated between mucinous and nonmucinous lesions, and amylase did not distinguish intraductal papillary mucinous neoplasms (IPMNs) from mucinous cystadenomas (MCAs). PMID: 26646270 In this study, we detected the tumor marker carcinoembryonic antigen (CEA) using the QD-LFTS system, which allowed quantitative analysis in the range of 1-100ng/mL with an ideal detection limit of 0.049ng/mL. Thus, the system is suitable for detecting CEA in the clinically accepted range. We also detected 70 positive and 30 negative serum samples using the Handing system, which exhibited good specificity and sensitivity. PMID: 27825889 As a proof-of-concept study, the constructed platform exhibits good specificity for CEA and the detection limit reaches as low as 8pg/mL (45 fM) with a wide linear range from 0.01 to 60ng/mL in the both cases PMID: 27886601 Under the optimal conditions, the proposed immunosensor was used for the detection of CEA with wide dynamic range in the range from 5 fg/mL to 50ng/mL with a low detection limit of 2fg/mL (S/N=3). PMID: 27871047 Relative CL intensity of all-in-one dual-aptasensor, operated with the competitive reaction of CEA and hemin in the presence of the dual aptamer, was exponentially decreased with the increase of CEA concentration in human serum PMID: 27875751 Data indicate that serum tumor markers showed significant shorter 3-year progression-free survival (PFS) in higher levels compared to lower levels for S-CYFRA 21-1 (cytokeratin 19 fragment), S-SCCA and S-CEA. PMID: 26432331 Multivariate logistic regression analysis revealed TC and DeltaCEA as independent factors in predicting TRG; TC showed a sensitivity of 62.79 %, a specificity of 91.49 %, a Youden index of 0.543, a cutoff value of 5.52, and an AUC of 0.800 compared with DeltaCEA (sensitivity 76.74 %, specificity 65.96 %, Youden index 0.427, and AUC 0.761). PMID: 26531721 Data suggest that joint detection of receptor-binding cancer antigen expressed on SiSo cells (RCAS1) and carcinoembryonic antigen (CEA) can improve the diagnostic sensitivity and specificity. PMID: 26438059 High CEA level is associated with Oral Squamous Cell Carcinoma. PMID: 27165212 High CEA expression is associated with metastasis and recurrence in endometrial cancer. PMID: 26779635 ZKSCAN3 appears to promote colorectal tumor progression and invasion. ZKSCAN3 may facilitate hepatic metastasis of CRC associated with CEA particularly in cases with CEA-producing tumor PMID: 27127149 we evaluated the clinical performance of LOCItrade mark-based tumor marker assays CEA, CA19-9, CA15-3, CA125 and AFP in patients with gastrointestinal cancer and demonstrated their high diagnostic power PMID: 28011514 High carcinoembryonic Antigen expression is associated with gastric cancer. PMID: 25124614 High CEA expression is associated with Squamous cell carcinoma of the skin. PMID: 27039776 Preparation of Au-polydopamine functionalized carbon encapsulated FeO magnetic nanocomposites and their application for ultrasensitive detection of carcino-embryonic antigen. PMID: 26868035 Elevated Carcinoembryonic Antigen Levels are associated with Colon Cancer. PMID: 26759308 Baseline serum CEA levels can serve as predictive factors for the treatment of EGFR-TKI in non-small cell lung cancer patients harboring EGFR mutations. PMID: 27072247 BALF and serum NSE, CEA, and CYFRA21.1 elevated in lung cancer, which had prompt value for pathology, especially significant for BALF. PMID: 27072263 Significant levels of CEA, CYFRA 21-1, NSE, and TSGF were detected in the serum. The amounts found were useful for diagnosing non-small cell lung cancer (NSCLC) patients who depended on the currently limited biomarker development. PMID: 27072222 We conclude that patients with high preoperative serum CEA levels should have more intensive follow-up for detection of synchronous liver metastasis. PMID: 26756614 Elevated CEA expression is associated with Gastric Cancer. PMID: 26620645 CEA, NSE, CA125 and pro-GRP could serve as biomarkers for SCLC, and CEA and CYFRA21-1 could serve as biomarkers for NSCLC. Pro-GRP, CA125 and CEA were related to the clinical stages of lung cancer PMID: 26560853 In this phase I/II study, 14 high-risk disease-free ovarian (OC) and breast cancer (BC) patients after completion of standard therapies were vaccinated with MUC1, ErbB2 and carcinoembryonic antigen (CEA) HLA-A2+-restricted peptides and Montanide. PMID: 26892612 combined pre-chemoradiotherapy CEA and post-chemoradiotherapy CEA levels enable more accurate prediction of rectal adenocarcinoma prognosis PMID: 26962798 ESCC patients with lower Cyfra21-1 and CEA, higher miR-7 and severe myelosuppression were much more sensitive to CRT. PMID: 26708917 Cyst fluid CEA levels have a clinically suboptimal accuracy level in differentiating pancreatic mucinous cystic neoplasms from pancreatic nonmucinous cystic neoplasms. PMID: 26077458 High carcinoembryonic antigen expression is associated with Colon Adenomas. PMID: 27100181 Serum CYFRA21-1 and CEA can be used as prognostic factors of NSCLC patients. Combinative detection of the two indices will be more reliable. PMID: 26333429

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.