Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Protein (His-SUMO)

Name: Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02863P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P40198
Target Symbol	CEACAM3
Synonyms	carcinoembryonic ; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACAM 3; CEACAM-3; Ceacam3; CEAM 3; CEAM-3; CEAM3; CEAM3_HUMAN; CGM1; Nonspecific cross reacting antigen; W264; W282
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Expression Range	35-155aa
Protein Length	Extracellular Domain
Mol. Weight	29.1kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, CEA family
Database References	HGNC: 1815 OMIM: 609142 KEGG: hsa:1084 STRING: 9606.ENSP00000349971 UniGene: PMID: 28886618 CEACAM3 signalling in neutrophils is able to specifically modulate airway inflammation caused by infection with M. catarrhalis. PMID: 27038042 Opacity protein OpaI of Neisseria gonorrhoeae in lipooligosaccharide mutants lost ability to interact with neutrophil-restricted CEACAM3. PMID: 27376801 p-CEA measurement in patients with pleural effusion of uncertain etiology is a safe and cost-effective procedure, everywhere easily available, which may help clinicians in selecting patients for further evaluations PMID: 27521620 Demonstrated the CEACAM3 specificity and a perioperative trend of circulating tumor cells which is coherent with the clinical/pathological considerations in colorectal cancer. PMID: 26556959 COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM PMID: 26162539 The higher expression of CD44v6, integrin-beta1, CA199, and CEA are closely related to the progression and metastasis of pancreatic cancer.[CA199, CD44v6] PMID: 22382453 A failure of CEACAM3-mediated innate immune detection might be linked to the ability of gonococci to cause disseminated infections. PMID: 23630956 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact PMID: 22948154 CEACAM3 promotes opsonin-independent phagocytosis of CEACAM-binding bacteria. CEACAM3 is the main driver for this process on human granulocytes. PMID: 22469950 the ability of CEACAM3 to coordinate signaling events that not only mediate bacterial uptake, but also trigger the killing of internalized pathogens. PMID: 21216968 CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance PMID: 20047061 CA-19.9 serum tumor marker levels retain independent prognostic value for poor survival in patients with advanced pancreatic cancer. PMID: 20071292 CEACAM3 has a role in internalizing bacteria to epithelial cells PMID: 12571236 CEACAM3 controls human-specific pathogens by the innate immune system. PMID: 14707113 Molecular staging of SLN using real-time RT-PCR for early breast cancer could serve as a useful complement to standard clinicopathological risk factors. PMID: 17071045 Increased p53, CEA, and CA 19-9 serum levels are associated with colorectal cancer. PMID: 17211733 Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features. PMID: 17413979 These data reveal CEACAM3 as a specific innate immune receptor that mediates the opsonin-independent clearance of CEACAM-binding bacteria via Syk, a molecular trigger for functional immunoreceptor responses of both the adaptive and innate immune systems. PMID: 17506820 killing of bulk NK cultures was inhibited by CEA-expressing cells, suggesting that this putative receptor is an inhibitory receptor PMID: 17878338 Increased CA 19-9 level is associated with pancreatic adenocarcinoma and cholangiocarcinoma. PMID: 19089662

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.