Recombinant Human Carboxypeptidase E (CPE) Protein (His-GST&Myc)

Name: Recombinant Human Carboxypeptidase E (CPE) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-01027P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carboxypeptidase E (CPE) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P16870
Target Symbol	CPE
Synonyms	(CPE)(Carboxypeptidase H)(CPH)(Enkephalin convertase)(Prohormone-processing carboxypeptidase)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN
Expression Range	252-363aa
Protein Length	Partial
Mol. Weight	47.7 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Sorting receptor that directs prohormones to the regulated secretory pathway. Acts also as a prohormone processing enzyme in neuro/endocrine cells, removing dibasic residues from the C-terminal end of peptide hormone precursors after initial endoprotease cleavage.
Subcellular Location	[Isoform 1]: Cytoplasmic vesicle, secretory vesicle. Cytoplasmic vesicle, secretory vesicle membrane; Peripheral membrane protein. Secreted.
Protein Families	Peptidase M14 family
Database References	HGNC: 2303 OMIM: 114855 KEGG: hsa:1363 STRING: 9606.ENSP00000386104 UniGene: PMID: 28656234 This study has uncovered a human CPE/NF-alpha1 gene mutation that could lead to comorbidity of dementia and depression, emphasizing the importance of this gene in cognitive function. PMID: 27922637 CPE through its N'-terminal sequence, forms aggregates with Wnt3a and possible endoplasmic reticulum (ER) stress leading to its loss of function. PMID: 27375026 we have identified a novel SNP in the CPE gene which results in the loss of its neuroprotective function in cells and may confer neurological disorders in humans PMID: 28114332 High-level CPE [ carboxypeptidase E] expression was associated with a poor prognosis in early-stage cervical cancer. CPE may serve as a biomarker for predicting PLNM [ pelvic lymph node metastasis ] and survival in these patients. PMID: 26695643 Low carboxypeptidase E expression is associated with recurrence in early-stage hepatocellular carcinoma. PMID: 26803519 Down-expression of liver carboxypeptidase E may reduce the secretion of serum cholecystokinin and contribute to the formation of cholesterol gallstone. PMID: 26228366 Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer. PMID: 25374060 Disruption of insulin receptor (IR) expression in beta cells has a direct impact on the expression of the convertase enzyme carboxypeptidase E (CPE) by inhibition of the eukaryotic translation initiation factor Eif4g1. PMID: 24843127 Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer. PMID: 24006921 Data suggest that splice variant of carboxypeptidase E (CPE-DeltaN) that CPE-DeltaN expression might be a potential prognostic marker for colorectal cancer patients. PMID: 23852859 CPE is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested PMID: 22998035 CPE forms a complex, probably through sequences located at its N-terminal domain, with Wnt3a and the extracellular cysteine rich domain of Fz1. PMID: 22824791 Neither high glucose nor insulin (with low glucose) regulates beta-cell CPE (but either up-regulates CPD). PMID: 21628999 an N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers PMID: 21285511 CPE may play a role in promoting tumor growth and invasion. PMID: 21061162 Carboxypeptidase E is differently expressed in subcutaneous and visceral fat of obese subjects PMID: 12530526 protein binding with Con A in seminal plasma PMID: 14690244 cDNA microarray analysis led to the identification of 2 novel biomarkers that should facilitate molecular diagnosis and further study of pulmonary neuroendocrine tumors. PMID: 15492986 A possible role for mutations in CPE in the development of coronary heart disease. PMID: 17957445 the severity of the coronary atherosclerosis estimated by Gensini score was significantly influenced by the presence of the A2925G mutant and G2855A mutant of the CPE gene PMID: 18080843 polymorphism in the CPE exon5 gene may contribute to the angiographical characteristics of coronary atherosclerosis in the Chinese population PMID: 18501121 Carboxypeptidase E degradation contributes to palmitate-induced beta-cell ER stress and apoptosis; CPE is a major link between hyperlipidemia and beta-cell death pathways in diabetes. PMID: 18550819 CPH-Abs may allow discrimination of a more latent subset of adult-onset autoimmune diabetes (LADA). PMID: 19120309 Carboxypeptidase E may be a key molecule to regulate Caspr2 (carboxypeptidase E) trafficking to the cell membrane. PMID: 19166515 missense polymorphism encoding altered activity PMID: 11462236

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.