Recombinant Human Carboxypeptidase D (CPD) Protein (His&Myc)
Recombinant Human Carboxypeptidase D (CPD) Protein (His&Myc)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Carboxypeptidase D (CPD) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | O75976 |
| Target Symbol | CPD |
| Synonyms | Metallocarboxypeptidase D gp180 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP |
| Expression Range | 383-461aa |
| Protein Length | Partial |
| Mol. Weight | 12.3 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Peptidase M14 family |
| Database References | HGNC: 2301 OMIM: 603102 KEGG: hsa:1362 STRING: 9606.ENSP00000225719 UniGene: PMID: 28364216 |
