Recombinant Human Carbonyl Reductase [Nadph] 1 (CBR1) Protein (GST)

Name: Recombinant Human Carbonyl Reductase [Nadph] 1 (CBR1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-11099P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Carbonyl Reductase [Nadph] 1 (CBR1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P16152
Target Symbol	CBR1
Synonyms	15 hydroxyprostaglandin dehydrogenase [NADP+]; 15-hydroxyprostaglandin dehydrogenase [NADP+]; Carbonyl reductase [NADPH] 1; Carbonyl Reductase 1; CBR 1; CBR1; CBR1_HUMAN; CRN; NADPH dependent carbonyl reductase 1; NADPH-dependent carbonyl reductase 1; Prostaglandin 9 ketoreductase; Prostaglandin 9-ketoreductase; Prostaglandin E(2) 9 reductase; Prostaglandin-E(2) 9-reductase; SDR21C1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Expression Range	45-320aa
Protein Length	Partial
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Subcellular Location	Cytoplasm.
Protein Families	Short-chain dehydrogenases/reductases (SDR) family
Database References	HGNC: 1548 OMIM: 114830 KEGG: hsa:873 STRING: 9606.ENSP00000290349 UniGene: Hs.88778
Tissue Specificity	Expressed in kidney (at protein level).

Gene Functions References

This study examined the impact of the functional single nucleotide polymorphism CBR1 rs9024 on the bioactivation of loxoprofen in a collection of human liver samples and tumor cell lines. PMID: 29851133
CRB1 is an efficient catalyst for the reduction of glutathionylated aldehydes derived from lipid peroxidation. PMID: 27562619
The ability of human carbonyl reductase 1 to efficiently catalyze the reduction of glutathionylated aldehydes derived from lipid peroxidation, that in the case of glutathionylated-4-hydroxyalkanals is associated to the ability to oxidize the hemiacetal hydroxyl group PMID: 28274719
Data suggest that fatty acids and acyl-CoAs bind competitively with respect to substrate binding to carbonyl reductase 1 (CBR1), an enzyme involved in first-pass drug metabolism in intestinal mucosa; inhibition of CBR1 by these products of digestion may lead to food-drug interactions. PMID: 28450226
AKR1C3 is the primary enzyme and CBR1 is a minor enzyme responsible for warfarin reduction in human liver cytosol. PMID: 27055738
These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1. PMID: 26499922
Results demonstrate a trend toward decreased functional expression of selective hepatic reductases in ESRD livers. PMID: 26282591
Critical insights into the substrate selectivity of hCBR1 and the interaction between hCBR1 and glutathione. PMID: 26381805
Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers PMID: 26328486
CBR1 decreases promoted tumor proliferation and growth as well as invasion and metastasis; CBR1 has potential to become a new candidate for molecular targeting therapy. PMID: 25572536
Inhibition of CBR1 may increase the efficacy of daunorubicin in cancer tissue. PMID: 25541467
Protein products of AKR1C1, AKR1C2, AKR7A3, CYP3A4, and carbonyl reductase (CBR1) were found in tumors and those of AKR1C1, AKR7A3, and CBR1 correlated with their transcript levels. PMID: 25526449
we suggest that PEP-1-CBR1 protein may be a therapeutic agent for the treatment of ischemic injuries as well as oxidative-stress-induced cell damage and death. PMID: 24440593
The stimulatory effect of cortisol on CBR1 expression may partly explain the concurrent increases of cortisol and prostaglandin PGF2alpha in human amnion tissue prior to the onset of labor PMID: 24654784
Nrf2 is a novel transcriptional regulator of CBR1 genes in humans. PMID: 23247010
GSNO-induced covalent modification of cysteine residues affects the kinetic mechanism of CBR1. PMID: 23295225
regulation of human CBR1 expression by hsa-miR-574-5p and hsa-miR-921 depends upon rs9024 genotype status PMID: 23133646
This pilot study suggests that CBR1 RNA expression may be helpful in identifying AML patients at risk of developing resistance or toxicity to daunorubicin due to increased formation of daunorubicinol. PMID: 22562609
CBR1 regulates cancer cell invasion in endometrial adenocarcinomas by regulating the epithelial mesenchymal transition PMID: 22542806
Polymorphisms in CBR1 gene did not increase risk of cardiomyopathy after anthracycline treatment of childhood cancers. PMID: 22124095
a physiological role of CBR1, but not for CBR3, in S-nitrosoglutathione reduction and thus ultimately in regulation of NO signaling PMID: 21256830
This protein has been found differentially expressed in thalami from patients with schizophrenia. PMID: 20471030
analysis of the structural basis for substrate specificity in human monomeric carbonyl reductases CBR1 PMID: 19841672
the functional genetic determinant of CBR1 activity toward relevant physiological and pharmacological substrates PMID: 17344335
The functional characterization of the promoter of CBR1 is reported. PMID: 17569794
Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles. PMID: 17697149
These results suggested that hCBR3 and hCBR1 play distinct physiological roles. PMID: 18493841
Human carbonyl reductase 1 is an S-nitrosoglutathione reductase PMID: 18826943
CBR1 polymorphisms have a significant influence on the pharmacokinetics of doxorubicin in Asian breast cancer patients. PMID: 19016765
the nonsynonymous single nucleotide polymorphisms generating mutations OF CBR1 may alter bioavailability of anthracyclines in cancer patients PMID: 19204081

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.