Recombinant Human Carbonic Anhydrase 6 (CA6) Protein (His&Myc)

Name: Recombinant Human Carbonic Anhydrase 6 (CA6) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00150P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carbonic Anhydrase 6 (CA6) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P23280
Target Symbol	CA6
Synonyms	(Carbonate dehydratase VI)(Carbonic anhydrase VI)(CA-VI)(Salivary carbonic anhydrase)(Secreted carbonic anhydrase)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Expression Range	18-308aa
Protein Length	Full Length of Mature Protein
Mol. Weight	41.0 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Reversible hydration of carbon dioxide. Its role in saliva is unknown.
Subcellular Location	Secreted.
Protein Families	Alpha-carbonic anhydrase family
Database References	HGNC: 1380 OMIM: 114780 KEGG: hsa:765 STRING: 9606.ENSP00000366662 UniGene: PMID: 28858874 Anti-CA6 was the most prevalent novel autoantibody in patients with dry eye, and was associated with younger age and more severe disease. Longitudinal studies are needed to determine whether anti-CA6 is a marker for early Sjogren's syndrome. PMID: 29504954 CA6 is a specific marker for serous acinar cells of salivary glands and acinic cell carcinoma (AciCC). PMID: 26212680 genetic association studies in population of elderly women in Poland: Data suggest that SNPs in TAS2R38 (rs713598, rs1726866, rs10246939) and an SNP in CA6 (rs2274333) are associated with intake of and preferences for some foods (coffee and white cabbage) among the population studied. (TAS2R38 = taste receptor type 2 member 38; CA6 = carbonic anhydrase VI) PMID: 28455260 Results found that the CA VI gene polymorphism rs2274327 showed no correlation between salivary parameters and dental-oral health status in Eastern Anatolian Turkish children. PMID: 27100223 dental plaque amount, lactobacilli count, age, and saliva buffer capacity, as well as CA6 (T55M) gene polymorphism, explained total of 87.8% of variations in DMFT scores. PMID: 26377569 We also found that the haplotype (ACA) (rs2274328, rs17032907 and rs11576766)of the carbonic anhydrase VI was associated with a low number of decayed, missing, and filled teeth index with an odds ratio (95% confidence interval) of 0.635 (0.440-0.918). PMID: 26125798 Study showed that PROP (6-n-propylthiouracil) bitterness was due to TAS2R38 diplotypes, whereas the density of fungiform papillae was more closely associated with gustin genotypes PMID: 25447475 SNPs associated with taste perception and taste bud anatomy PMID: 24534176 results suggest that polymorphisms in the CA6 gene are associated with the concentrations of secreted CA VI. PMID: 23652931 The rs2274333 polymorphism of the gustin gene affects PROP sensitivity. PMID: 24040192 The aim of this study was to investigate carbonic anhydrase (CA) VI Exon 2 single nucleotide polymorphism (SNP) and its possible association with salivary parameters in type 2 diabetic patients compared to healthy adults. PMID: 22198626 The 1.9A crystal structure of the human CA VI catalytic domain reveals a prototypical mammalian CA fold, and a novel dimeric arrangement as compared to previously-reported CA structures. PMID: 22366092 The data of this study showed how the combination of the TAS2R38 and gustin gene genotypes modulate PROP phenotype. PMID: 21712049 The polymerase chain reaction followed by restriction fragment length polymorphism assay described here can be used as an alternative to sequencing in bitter taster status research, and could be employed as a survey tool in nutrigenomic studies. PMID: 21631296 The gustin gene dimorphism rs2274333 observed in supertaster and nontaster subjects may influence the protein conformation and, thereby, affect zinc ion binding. PMID: 20631203 analysis of allele & genotype distribution of 3 polymorphisms in CA6 gene; no association between polymorphisms in exons 2 & 3 & caries experience; positive association between salivary buffer capacity & rs2274327 PMID: 19721466 The cloning, expression and purification of this isozyme are reported. PMID: 17499996

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.