Recombinant Human Carbonic Anhydrase 5A, Mitochondrial (CA5A)
Beta LifeScience
SKU/CAT #: BLC-01323P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Carbonic Anhydrase 5A, Mitochondrial (CA5A)
Beta LifeScience
SKU/CAT #: BLC-01323P
Regular price
$1,91300
$1,913.00
Sale price$9900
$99.00Save $1,814
/
Product Overview
Description | Recombinant Human Carbonic Anhydrase 5A, Mitochondrial (CA5A) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P35218 |
Target Symbol | CA5A |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | Tag-Free |
Target Protein Sequence | CAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS |
Expression Range | 39-305aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 30.6 kDa |
Research Area | Metabolism |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Reversible hydration of carbon dioxide. Low activity. |
Subcellular Location | Mitochondrion. |
Protein Families | Alpha-carbonic anhydrase family |
Database References | |
Associated Diseases | Hyperammonemia due to carbonic anhydrase VA deficiency (CA5AD) |
Gene Functions References
- In 10 of 96 patients, mutations in CA5A were identified on both alleles but none in CA5B. Exhibiting decreased enzyme activity or thermal stability, all CAVA mutations were proven to cause disease, whereas the three variants showed no relevant effect PMID: 26913920
- CA5A alterations cause hyperammonemia in early childhood that result in mitochondrial carbonic anhydrase VA deficiency PMID: 24530203
- activators enhanced kcat, with no effect on KM, favoring the RDS in the catalytic cycle; the activation pattern of the two mitochondrial isoforms is very different from each other and as compared to those of the cytosolic isoforms hCA I and II. PMID: 17174092