Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05689P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05689P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
| Uniprotkb | P22748 |
| Target Symbol | CA4 |
| Synonyms | CA IV; CA4; CAH4_HUMAN; CAIV ; Car4 ; Carbonate dehydratase IV; Carbonic anhydrase 4; Carbonic dehydratase; Carbonic dehydratase IV ; EC 4.2.1.1; Retinitis pigmentosa 17 (autosomal dominant); RP17 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | C-6His |
| Complete Sequence | AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK |
| Expression Range | 19-283aa |
| Protein Length | Partial |
| Mol. Weight | 31.43 kDa |
| Research Area | Neuroscience |
| Form | Liquid |
| Buffer | 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid. |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
| Protein Families | Alpha-carbonic anhydrase family |
| Database References | HGNC: 1375 OMIM: 114760 KEGG: hsa:762 STRING: 9606.ENSP00000300900 UniGene: PMID: 26071132 |
