Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active

Name: Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05689P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carbonic Anhydrase 4 (CA4) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 500 pmol/min/ug
Uniprotkb	P22748
Target Symbol	CA4
Synonyms	CA IV; CA4; CAH4_HUMAN; CAIV ; Car4 ; Carbonate dehydratase IV; Carbonic anhydrase 4; Carbonic dehydratase; Carbonic dehydratase IV ; EC 4.2.1.1; Retinitis pigmentosa 17 (autosomal dominant); RP17
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-6His
Complete Sequence	AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Expression Range	19-283aa
Protein Length	Partial
Mol. Weight	31.43 kDa
Research Area	Neuroscience
Form	Liquid
Buffer	0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families	Alpha-carbonic anhydrase family
Database References	HGNC: 1375 OMIM: 114760 KEGG: hsa:762 STRING: 9606.ENSP00000300900 UniGene: PMID: 26071132 Carbonic anhydrase 4 is lost in papillary thyroid carcinoma but not thyroid nodules PMID: 24880201 Although CA IV has been shown to be active in mediating CO2 and HCO3 (-) transport in many important tissues like kidney and lung, and in isolated cells from brain and muscle, the gene for CA IV appears not to be essential. PMID: 24146379 Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity. PMID: 24338019 membrane-associated CA IV contributes robust catalytic activity intracellularly, and this activity participates in regulating H(+) dynamics in the cytosol PMID: 23297198 Two SNPs of carbonic anhydrase IV, which are responsible for amino acid changes, were found. The frequencies of these SNPs were not significantly different between the caries-free group and the group with caries PMID: 22021688 compared the subcellular localization and post-translational processing of wild-type (WT)- and retinitis pigmentosa 17 mutant-CAIV in three cell types PMID: 20626030 The results suggest that the expression level of carbonic anhydrase IV may be important to maintain retina function in retinitis pigmentosa. PMID: 20450258 renal injury inflicted by expression of human carbonic anhydrase IV folding mutants was markedly enhanced by haploinsufficiency of the endoplasmic reticulum cochaperone p58(IPK). PMID: 20308551 binding by extracellular loop 4 of the human AE1 Cl-/HCO3- exchanger PMID: 11994299 carbonic anhydrase IV binds EC4 of NBC1, and this interaction is essential for full NBC1 activity PMID: 14567693 mutation was found to cosegregate with the retinitis pigmentosa RP17 phenotype in two large families PMID: 15090652 CA inhibitors may have long-term adverse effects on vision. PMID: 15563508 characterized the CA IV expressed in Capan-1 cells PMID: 17409381 A novel mutation has been identified in CA4 that provides further evidence that impaired pH regulation may underlie photoreceptor degeneration in retinitis pigmentosa PMID: 17652713 CAIV p.R14W sequence variant found in one of the patients with Bothnia dystrophy phenotype is benign polymorphism in population of northern Sweden. PMID: 18344446 Apoptosis induced by the CA IV mutants could be prevented, at least partially, by treating the cells with dorzolamide, a CA inhibitor PMID: 19211803

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.