Recombinant Human Carbonic Anhydrase 2 (CA2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04331P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Carbonic Anhydrase 2 (CA2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04331P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Carbonic Anhydrase 2 (CA2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P00918 |
| Target Symbol | CA2 |
| Synonyms | CA 2; CA II; CA-II; Ca2; CAC; CAH2_HUMAN; CAII; Car 2; Car2; Carbonate dehydratase II; Carbonic anhydrase 2; Carbonic anhydrase B; Carbonic anhydrase C; Carbonic anhydrase C; formerly; Carbonic anhydrase II; Carbonic dehydratase; epididymis luminal protein 76; Epididymis secretory protein Li 282; HEL-76; HEL-S-282 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK |
| Expression Range | 2-260aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 45.1 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6. |
| Subcellular Location | Cytoplasm. Cell membrane. Note=Colocalized with SLC26A6 at the surface of the cell membrane in order to form a bicarbonate transport metabolon. Displaced from the cytosolic surface of the cell membrane by PKC in phorbol myristate acetate (PMA)-induced cells. |
| Protein Families | Alpha-carbonic anhydrase family |
| Database References | HGNC: 1373 OMIM: 259730 KEGG: hsa:760 STRING: 9606.ENSP00000285379 UniGene: PMID: 30066203 |
