Recombinant Human Carbonic Anhydrase 13 (CA13) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05615P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Carbonic Anhydrase 13 (CA13) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05615P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Carbonic Anhydrase 13 (CA13) Protein (His), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The esterase activity is determined to be greater than 1000 pmol/min/ug |
| Uniprotkb | Q8N1Q1 |
| Target Symbol | CA13 |
| Synonyms | CA 13; CA XIII; CA-XIII; CA13; CA13 carbonic anhydrase XIII ; CAH13_HUMAN; Carbonate dehydratase XIII; Carbonic anhydrase 13; Carbonic anhydrase XIII; CAXIII; EC=4.2.1.1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | C-6His |
| Complete Sequence | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH |
| Expression Range | 1-262aa |
| Protein Length | Full Length |
| Mol. Weight | 30.51 kDa |
| Research Area | Cell Biology |
| Form | Liquid |
| Buffer | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Reversible hydration of carbon dioxide. |
| Protein Families | Alpha-carbonic anhydrase family |
| Database References | HGNC: 14914 OMIM: 611436 KEGG: hsa:377677 UniGene: PMID: 14600151 |
