Recombinant Human Carbonic Anhydrase 1 (CA1) Protein (His), Active

Name: Recombinant Human Carbonic Anhydrase 1 (CA1) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05616P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Carbonic Anhydrase 1 (CA1) Protein (His), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 500 pmol/min/ug
Uniprotkb	P00915
Target Symbol	CA1
Synonyms	CA 1; CA I; CA-I; CA1; CAB; CAH1_HUMAN; CAI; CAN; Car 1; Car1; Carbonate dehydratase I; Carbonic anhydrase 1; Carbonic anhydrase A; Carbonic anhydrase B; Carbonic anhydrase B; formerly; Carbonic anhydrase I; Carbonic dehydratase; ECK0125; JW0122; yadF
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-6His
Complete Sequence	ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Expression Range	2-261aa
Protein Length	Full Length of Mature Protein
Mol. Weight	29.93 kDa
Research Area	Cell Biology
Form	Liquid
Buffer	0.2 μm Filtered 12.5mM Tris HCl, 75mM NaCl, pH 7.5.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Subcellular Location	Cytoplasm.
Protein Families	Alpha-carbonic anhydrase family
Database References	HGNC: 1368 OMIM: 114800 KEGG: hsa:759 STRING: 9606.ENSP00000256119 UniGene: PMID: 28270370 These six-membered carbocycles showed nice inhibitory action against AChE and human carbonic anhydrase (hCA) II and I isoforms. The hCA I, II, and AChE were efficiently inhibited by these molecules, with Ki values in the range of 6.70-35.85 nM for hCA I, 18.77-60.84 nM for hCA II, and 0.74-4.60 for AChE, respectively PMID: 28613396 These results showed that flavonoids especially malvin and oenin effectively inhibited hCA I and II isoenzymes. PMID: 28445001 Discovery of potent carbonic anhydrase, acetylcholinesterase, and butyrylcholinesterase enzymes inhibitors: The new amides and thiazolidine-4-ones synthesized on an acetophenone base. PMID: 28544359 Here are presented solved the first crystal structures of carbonic anhydrase 1and carbonic anhydrase 2 in complex with polmacoxib, at 2.0 A and 1.8 A, respectively. PMID: 27475498 Neuronal carbonic anhydrase I (CA1) appears to be associated with the endoplasmic reticulum subcellular structure. PMID: 27809276 CA1 is highly expressed in the sera of stage I non-small cell lung cancer patients PMID: 26232327 We demonstrated that resveratrol, caffeic acid, and tannic acid in stored blood could decrease the sensitivity to oxidation of erythrocytes in vitro but did not exhibit such effects on Carbonic Anhydrase activity. PMID: 27413740 CA1 is a potential oncogene and that it contributes to abnormal cell calcification, apoptosis and migration in breast cancer. PMID: 26459317 We report on the competitive zinc metalation of apo-carbonic anhydrase [CA; metal-free CA (apo-CA)] in the presence of apo-metallothionein 1A domain fragments to identify domain specific determinants of zinc binding and zinc donation PMID: 26475450 The gene encoding CA1 is susceptible to ankylosing spondylitis and plays a role in the process of bone formation. PMID: 22838845 Structure-activity relationships study showed that indolylchalcone derivatives have higher inhibitory activities than pyrido[2,3-d]pyrimidine derivatives on hCA I and hCA II. PMID: 25165709 Myocardial carbonic anhydrase 1/2 activation is significantly elevated in diabetic ischemic cardiomyopathy. PMID: 24670789 may be involved in the pathogenesis of Abdominal aortic aneurysm PMID: 23557951 The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients. PMID: 22996014 A significant correlation was found between positive carbonic anhydrase I staining and oral squamous cell carcinoma for more advanced clinical stage and larger tumor size, but not for positive lymph node metastasis, distal metastasis, and recurrence. PMID: 22416960 carbonic anhydrase I, phosphoglycerate kinase 1 and apolipoprotein A-I appeared to be the most significant variations of proteins in patients with osteopenia and osteoarthritis PMID: 22619369 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration. PMID: 22360420 Overexpression of CA1 in the synovial tissues of ankylosing spondylitis (AS) patients may promote improper calcification and bone resorption in AS. PMID: 21143847 single mutation of an amino acid not considered essential to catalysis (Phe91Asn) in carbonic anhydrase I, but is near substrate binding pocket, led to increase of catalytic activity; mutant CA I also showed higher affinity for sulfonamide inhibitors PMID: 20624682 The X-ray crystallographic structure of the CA I Michigan 1 variant isozyme is reported, both in the presence and absence of a second bound zinc ion coordinated to His 64, His 200, and Arg 67. PMID: 12009884 concentrations in nondialyzed chronic kidney disease patients, and the relationship with acidosis, zinc, anemia, and iron supplementation PMID: 14675565 cytosolic CA I, II, and XIII are downregulated in neoplastic colorectal mucosa compared to normal colorectal mucosa PMID: 15836783 Isothiocyanato sulfonamide thioureas inhibit this enzyme. PMID: 15837325 X-ray crystallographic structure for the adduct of an activator with hCA I. Binding site interactions of activator L-Histidine with active site amino acids PMID: 16870440 study presents the X-ray structure of the foscarnet adduct with CA1 together with the factors governing recognition of such small molecules by a metalloenzyme active site PMID: 17314045 Decreased levels of carbonic anhydrase 1 isozyme is associated with type II diabetes. PMID: 17464559

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.