Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07925P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07925P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P34972 |
Target Symbol | CNR2 |
Synonyms | CNR2; CB2A; CB2B; Cannabinoid receptor 2; CB-2; CB2; hCB2; CX5 |
Species | Homo sapiens (Human) |
Expression System | in vitro E.coli expression system |
Tag | N-10His |
Target Protein Sequence | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
Expression Range | 1-360aa |
Protein Length | Full Length |
Mol. Weight | 42.5 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon. |
Protein Families | G-protein coupled receptor 1 family |
Database References | |
Tissue Specificity | Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl |
Gene Functions References
- Among 1027 obese patients, genotypes GG, GA, and AA were found in 339 (33.0%), 467 (45.5%), and 221 (21.5%) respectively. Body mass index, weight, fat mass, waist circumference, insulin, HOMA-IR, and triglyceride and leptin levels were higher in A-allele carriers as compared to non A-allele carriers. No differences were seen in these parameters between the GA and AA genotypes. PMID: 28895540
- in immune cells, activation of both CB2R variants 63Q and 63R causes phosphorylation of ERK; however, the signal intensity caused by 63R activation is relatively weaker than that caused by 63Q activation PMID: 29694791
- The cannabinoid receptor type 2 (CB2) Q63R variation is associated with increased risk of hospitalization in children with acute respiratory tract infection (ARTI). Children carrying the QQ genotype are more prone to developing severe ARTI. The associated risk of developing severe ARTI following RSV infection increases in children carrying the Q allele PMID: 28992427
- Urinary bladder cancer cell growth and motility implicate cannabinoid 2 receptor-mediated modifications of sphingolipids metabolism. PMID: 28191815
- Study shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells. PMID: 28336953
- This study found enhanced CNR2 mRNA levels in all Low Back Pain participants. PMID: 28481838
- Carriers of the minor allele of rs3123554 variant of CB2R gene loose less body weight during two different hypocaloric diets. The improvement of metabolic parameters was better in no A allele carriers than A allele carriers. PMID: 29518488
- CB2 activation with sub-micromolar doses of agonists, which could be more similar to endogenous levels of cannabinoids, promote colon cancer progression in a process that involves AKT and GSK3beta. PMID: 27634891
- stimulation of MAPK contributes to the peripheral analgesic effect of CB2 receptor agonists. PMID: 26108183
- Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID: 27013280
- Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID: 26850094
- analysis of the interplay between the CB2-RR variant and liver necroinflammation in chronic hepatitis patients with HIV/HCV coinfection PMID: 28759568
- Patients with schizophrenia showed increased CB2R expression in cells of the innate immune system and simpler correlation network between cytokines and CBRs expression when compared with controls. PMID: 28011441
- Cannabinoid Receptor 2 mutation is associated with obesity. PMID: 27294325
- The type 2 cannabinoid (Cnr2) receptor is implicated in cancer, bone metabolism and pain perception. Emerging data have uncovered the role of Cnr2 in the regulation of tumour-bone cell interactions and suggest that agents that target Cnr2 in the skeleton have potential efficacy in the reduction of skeletal complications associated with cancer. [review] PMID: 28274851
- The prevalence of chronic HCV infected patients with the CB2-63 RR variant was significantly higher in the immune-mediated disorder (IMD) than in the non-IMD group. The data suggest a significant, previously unknown, independent association between the CB2-63 RR variant and IMDs in anti-HCV-positive patients. PMID: 27476469
- CNR2 gene has an important role in the etiology of osteoporosis and suggest that it may be a genetic risk factor for BMD and osteoporosis in Han Chinese postmenopausal women. PMID: 26055357
- A histological activity index (HAI) > 8 (Ishak scoring) was more frequent in patients with CB2-63 RR than in those with CB2-63 QR or QQ (37% vs. 16.7%, p < 0.05). PMID: 25749560
- Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse model PMID: 25863279
- Association between the CB2 Q63R functional variant and the age at menarche in obese girls. PMID: 26447698
- CB2 receptor activation can attenuate HAND severity by inhibiting HIV replication, blunting HIV-triggered neuroinflammation, preventing HIV-induced damage to Blood-brain-barrier integrity, and preventing HIV-associated synapse loss. PMID: 25015040
- Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis. PMID: 26195631
- Targeting CB2 may represent an attractive approach to treat cancers of immune origin. PMID: 25640641
- results suggest that rs2501431, rs3003336, rs2229579, and rs4237 polymorphisms in CNR2 genes may be genetic factors affecting bone mineral density in Korean postmenopausal women PMID: 25268406
- no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivity PMID: 25444073
- up-regulated expression of hCB2R could induce cell apoptosis by enhancing the expressions of Bax, Bad and suppressing the expression of Bcl-2 in Caski cells PMID: 26062417
- data from this study suggested that activation of CB2 receptor plays important role in osteogenic differentiation of BM-MSCs. Lack of CB2 receptor may be related to osteoporosis. PMID: 25685815
- Cannabinoid receptor type 2 contributes to susceptibility to oligo/polyarticular juvenile idiopathic arthritis and to the severity of its clinical course. PMID: 25974389
- These pilot findings suggest that CB2 Q63R polymorphism does not play a major role in genetic susceptibility to inflammatory bowel disease or in its disease phenotypes among Turkish subjects PMID: 25599774
- findings reveal an unprecedented role of CB2 as a pivotal regulator of HER2 pro-oncogenic signaling in breast cancer, and they suggest that CB2 may be a biomarker with prognostic value in these tumors. PMID: 25855725
- The CB2-63 QQ variant in HCV patients was independently associated with the persistently normal alanine aminotransferase status. PMID: 24940753
- The present study shows CB2 is expressed in human post-mortem striatum in Huntington's disease PMID: 24978314
- Amino acids Valine113 and Leucine192 play important roles in ligand binding and downstream signaling transduction of the CB2 receptor. PMID: 25148941
- CB2R and GPR55 form heteromers in cancer cells, these structures possess unique signaling properties, and modulation of these heteromers can modify the antitumoral activity of cannabinoids in vivo PMID: 24942731
- Increased CB2 mRNA and anandamide in human blood after cessation of cannabis abuse PMID: 24788457
- Activation of CB2 receptors reduces adhesion and transmigration of melanoma cells through the cerebral endothelium. PMID: 24815068
- association of the minor allele of SNP rs3123554 within the CNR2 gene with lower BMI and body fat; significant association of the SNP with BMI was limited to females PMID: 23839870
- CB2R activation drives an altered phenotype of foam cells, by negatively regulating lipid influx and/or by modulating cytokine profile PMID: 24529123
- The mRNA level for cannabinoid receptor type 2 (CB2) was significantly increased in peripheral blood mononuclear cells from autistic children as compared to healthy subjects PMID: 23585028
- applied a comprehensive G protein-coupled receptor-Galphai protein chemical cross-linking strategy to map the cannabinoid receptor subtype 2 (CB2)-Galphai interface and then used molecular dynamics simulations to explore the dynamics of complex formation PMID: 24855641
- Data suggest that ligand binding to CNR2 (either recombinant or constitutive) is important to agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues/spleen). PMID: 23711022
- The functional role of intracellular CB2 receptors has been defined and linked to calcium signaling. PMID: 25033246
- The global fold of human cannabinoid type 2 (CB2 ) receptor in the agonist-bound active state in lipid bilayers was studied. PMID: 23999926
- Antagonism of cannabinoid receptor 2 pathway suppresses IL-6-induced immunoglobulin IgM secretion. PMID: 24913620
- cultures of hMSCs express all of the components of the endocannabinoid system and suggest a potential role for the cannabinoid CB2 receptor as a mediator of MSC anti-inflammatory properties, as well as for their survival pathways. PMID: 24312195
- The CB2-63 QQ variant of CNR2 is associated with more severe inflammation and hepatocellular necrosis in patients with HCV infection. PMID: 23707465
- CB2 receptor expression in proximal tubule cells is modulated by internalization of albumin. PMID: 24280624
- Report synthesis of carbazole derived CB(2) ligands/agonists with increased polarity. PMID: 24243315
- In rheumatoid arthritis patients' synovial fibroblasts, proinflammatory mediators up-regulate the expression of cannabinoid receptor 2, which negatively regulates the production of proinflammatory cytokines and matrix metalloproteinases. PMID: 24440992
- selective CB2 activation in leukocytes decreases key steps in monocyte-blood-brain barrier engagement. PMID: 24055259