Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His)

Name: Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07925P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cannabinoid Receptor 2 (CNR2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P34972
Target Symbol	CNR2
Synonyms	CNR2; CB2A; CB2B; Cannabinoid receptor 2; CB-2; CB2; hCB2; CX5
Species	Homo sapiens (Human)
Expression System	in vitro E.coli expression system
Tag	N-10His
Target Protein Sequence	MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Expression Range	1-360aa
Protein Length	Full Length
Mol. Weight	42.5 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 2160 OMIM: 605051 KEGG: hsa:1269 STRING: 9606.ENSP00000363596 UniGene: PMID: 28895540 in immune cells, activation of both CB2R variants 63Q and 63R causes phosphorylation of ERK; however, the signal intensity caused by 63R activation is relatively weaker than that caused by 63Q activation PMID: 29694791 The cannabinoid receptor type 2 (CB2) Q63R variation is associated with increased risk of hospitalization in children with acute respiratory tract infection (ARTI). Children carrying the QQ genotype are more prone to developing severe ARTI. The associated risk of developing severe ARTI following RSV infection increases in children carrying the Q allele PMID: 28992427 Urinary bladder cancer cell growth and motility implicate cannabinoid 2 receptor-mediated modifications of sphingolipids metabolism. PMID: 28191815 Study shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells. PMID: 28336953 This study found enhanced CNR2 mRNA levels in all Low Back Pain participants. PMID: 28481838 Carriers of the minor allele of rs3123554 variant of CB2R gene loose less body weight during two different hypocaloric diets. The improvement of metabolic parameters was better in no A allele carriers than A allele carriers. PMID: 29518488 CB2 activation with sub-micromolar doses of agonists, which could be more similar to endogenous levels of cannabinoids, promote colon cancer progression in a process that involves AKT and GSK3beta. PMID: 27634891 stimulation of MAPK contributes to the peripheral analgesic effect of CB2 receptor agonists. PMID: 26108183 Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID: 27013280 Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID: 26850094 analysis of the interplay between the CB2-RR variant and liver necroinflammation in chronic hepatitis patients with HIV/HCV coinfection PMID: 28759568 Patients with schizophrenia showed increased CB2R expression in cells of the innate immune system and simpler correlation network between cytokines and CBRs expression when compared with controls. PMID: 28011441 Cannabinoid Receptor 2 mutation is associated with obesity. PMID: 27294325 The type 2 cannabinoid (Cnr2) receptor is implicated in cancer, bone metabolism and pain perception. Emerging data have uncovered the role of Cnr2 in the regulation of tumour-bone cell interactions and suggest that agents that target Cnr2 in the skeleton have potential efficacy in the reduction of skeletal complications associated with cancer. [review] PMID: 28274851 The prevalence of chronic HCV infected patients with the CB2-63 RR variant was significantly higher in the immune-mediated disorder (IMD) than in the non-IMD group. The data suggest a significant, previously unknown, independent association between the CB2-63 RR variant and IMDs in anti-HCV-positive patients. PMID: 27476469 CNR2 gene has an important role in the etiology of osteoporosis and suggest that it may be a genetic risk factor for BMD and osteoporosis in Han Chinese postmenopausal women. PMID: 26055357 A histological activity index (HAI) > 8 (Ishak scoring) was more frequent in patients with CB2-63 RR than in those with CB2-63 QR or QQ (37% vs. 16.7%, p < 0.05). PMID: 25749560 Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse model PMID: 25863279 Association between the CB2 Q63R functional variant and the age at menarche in obese girls. PMID: 26447698 CB2 receptor activation can attenuate HAND severity by inhibiting HIV replication, blunting HIV-triggered neuroinflammation, preventing HIV-induced damage to Blood-brain-barrier integrity, and preventing HIV-associated synapse loss. PMID: 25015040 Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis. PMID: 26195631 Targeting CB2 may represent an attractive approach to treat cancers of immune origin. PMID: 25640641 results suggest that rs2501431, rs3003336, rs2229579, and rs4237 polymorphisms in CNR2 genes may be genetic factors affecting bone mineral density in Korean postmenopausal women PMID: 25268406 no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivity PMID: 25444073 up-regulated expression of hCB2R could induce cell apoptosis by enhancing the expressions of Bax, Bad and suppressing the expression of Bcl-2 in Caski cells PMID: 26062417 data from this study suggested that activation of CB2 receptor plays important role in osteogenic differentiation of BM-MSCs. Lack of CB2 receptor may be related to osteoporosis. PMID: 25685815 Cannabinoid receptor type 2 contributes to susceptibility to oligo/polyarticular juvenile idiopathic arthritis and to the severity of its clinical course. PMID: 25974389 These pilot findings suggest that CB2 Q63R polymorphism does not play a major role in genetic susceptibility to inflammatory bowel disease or in its disease phenotypes among Turkish subjects PMID: 25599774 findings reveal an unprecedented role of CB2 as a pivotal regulator of HER2 pro-oncogenic signaling in breast cancer, and they suggest that CB2 may be a biomarker with prognostic value in these tumors. PMID: 25855725 The CB2-63 QQ variant in HCV patients was independently associated with the persistently normal alanine aminotransferase status. PMID: 24940753 The present study shows CB2 is expressed in human post-mortem striatum in Huntington's disease PMID: 24978314 Amino acids Valine113 and Leucine192 play important roles in ligand binding and downstream signaling transduction of the CB2 receptor. PMID: 25148941 CB2R and GPR55 form heteromers in cancer cells, these structures possess unique signaling properties, and modulation of these heteromers can modify the antitumoral activity of cannabinoids in vivo PMID: 24942731 Increased CB2 mRNA and anandamide in human blood after cessation of cannabis abuse PMID: 24788457 Activation of CB2 receptors reduces adhesion and transmigration of melanoma cells through the cerebral endothelium. PMID: 24815068 association of the minor allele of SNP rs3123554 within the CNR2 gene with lower BMI and body fat; significant association of the SNP with BMI was limited to females PMID: 23839870 CB2R activation drives an altered phenotype of foam cells, by negatively regulating lipid influx and/or by modulating cytokine profile PMID: 24529123 The mRNA level for cannabinoid receptor type 2 (CB2) was significantly increased in peripheral blood mononuclear cells from autistic children as compared to healthy subjects PMID: 23585028 applied a comprehensive G protein-coupled receptor-Galphai protein chemical cross-linking strategy to map the cannabinoid receptor subtype 2 (CB2)-Galphai interface and then used molecular dynamics simulations to explore the dynamics of complex formation PMID: 24855641 Data suggest that ligand binding to CNR2 (either recombinant or constitutive) is important to agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues/spleen). PMID: 23711022 The functional role of intracellular CB2 receptors has been defined and linked to calcium signaling. PMID: 25033246 The global fold of human cannabinoid type 2 (CB2 ) receptor in the agonist-bound active state in lipid bilayers was studied. PMID: 23999926 Antagonism of cannabinoid receptor 2 pathway suppresses IL-6-induced immunoglobulin IgM secretion. PMID: 24913620 cultures of hMSCs express all of the components of the endocannabinoid system and suggest a potential role for the cannabinoid CB2 receptor as a mediator of MSC anti-inflammatory properties, as well as for their survival pathways. PMID: 24312195 The CB2-63 QQ variant of CNR2 is associated with more severe inflammation and hepatocellular necrosis in patients with HCV infection. PMID: 23707465 CB2 receptor expression in proximal tubule cells is modulated by internalization of albumin. PMID: 24280624 Report synthesis of carbazole derived CB(2) ligands/agonists with increased polarity. PMID: 24243315 In rheumatoid arthritis patients' synovial fibroblasts, proinflammatory mediators up-regulate the expression of cannabinoid receptor 2, which negatively regulates the production of proinflammatory cytokines and matrix metalloproteinases. PMID: 24440992 selective CB2 activation in leukocytes decreases key steps in monocyte-blood-brain barrier engagement. PMID: 24055259

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.