Recombinant Human Cancer/Testis Antigen 1 (CTAG1A) Protein (His)

Name: Recombinant Human Cancer/Testis Antigen 1 (CTAG1A) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03687P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CTAG1A.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Cancer/Testis Antigen 1 (CTAG1A) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P78358
Target Symbol	CTAG1A
Synonyms	CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His
Target Protein Sequence	MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Expression Range	1-180aa
Protein Length	Full Length
Mol. Weight	21.6kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Cytoplasm.
Protein Families	CTAG/PCC1 family
Database References	HGNC: 24198 OMIM: 300156 KEGG: hsa:1485 STRING: 9606.ENSP00000332602 UniGene: PMID: 29058035 A significant association was found between AKAP4 gene expression and metastasis (P-value: 0.045), expression of the CTAG1B (NY-ESO-1) gene was not observed in our cases. PMID: 29480665 In 22 melanoma patients with stage III lymph node metastasis, overall survival was significantly higher in the XAGE-1b and NY-ESO-1 double-negative group than in the other groups. PMID: 28105694 The present results indicate the strong humoral immune response against NY-ESO-1 in natural human T-cell leukemia virus type 1 infection, irrespective of the clinical status. PMID: 28716148 some autoantibodies, such as anti-MAGEA4, anti-CTAG1 or anti-TP53 and their combinations could possibly contribute to the development of cancer early detection tests (not necessarily restricted to gastric cancer) when being combined with other markers. PMID: 27140836 High NY-ESO-1 expression is associated with Lung Cancer. PMID: 27793776 Results support the potential utility of NY-ESO-1, PRAME, and MAGEA4 as targets for immunotherapy and as ancillary prognostic parameters in synovial sarcomas. PMID: 27993576 Data suggest that only a small fraction of HLA-A*02:01- (HA)-binding ESO peptides are immunogenic, namely those that have high peptide-binding strength and peptide/HA complex stability. This study involved comparison of in silico-predicted and observed cytotoxic T-lymphocyte recognition of tumor antigen epitopes in melanoma patients and transgenic/knockout mice. (ESO = tumor antigen NY-ESO-1) PMID: 28536262 These data demonstrate that MAGE-A1-, MAGE-A3-, and NY-ESO-1-specific T cells with antigen-specific cytotoxicity can be cultured from healthy donors and patient-derived cells making adoptive immunotherapy with these cytotoxic T lymphocyte feasible. PMID: 28677424 Comparing the overall expression of CTAs, a decreased expression of all melanoma-associated antigens (MAGEs) post-treatment and a slightly increased expression of New York esophageal squamous cell carcinoma 1 (NY-ESO-1) was visible. The simultaneous cytoplasmic and nuclear expression of pan-MAGE or MAGE-A3/A4 correlated with reduced treatment-failure-free-survival (TFFS). PMID: 27466502 MAGE-A is more highly expressed than NY-ESO-1 in a majority of human malignancies PMID: 27070449 These cells were used to target a human lung cancer line that expressed NY-ESO-1. PMID: 26324743 regulation of NY-ESO-1 processing by the ubiquitin receptors Rpn10 and Rpn13 as a well as by the standard and immunoproteasome is governed by non-canonical ubiquitination on non-lysine sites. PMID: 26903513 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors. PMID: 26191258 Among mesenchymal tumors, myxoid liposarcomas showed the highest positivity for NY-ESO-1 (88%), followed by synovial sarcomas (49%), myxofibrosarcomas (35%), and conventional chondrosarcomas (28%). PMID: 25412843 High expression of NY-ESO-1 is associated with Triple-Negative Breast Cancer. PMID: 26413775 NY-ESO-1 expression in melanoma was associated with tumor progression, including increased tumor thickness, and with reduced tumor infiltrating lymphocytes. PMID: 25954764 NY-ESO-1 is expressed in esophageal adenocarcinomas, Barrett's metaplasia and normal tissues other than germ cells PMID: 24744590 NY-ESO-1 cancer antigen expression has a role in immunotherapy in thyroid cancer PMID: 24811699 primary autoantibodies against intracellular MM-specific tumor antigens SSX-2 and NY-ESO-1 are rare but functional in multiple myeloma patients after allogeneic stem cell transplantation PMID: 25078248 We have also shown that NY-ESO-1 expression may lead to humoral immune response in patients with meningioma. PMID: 24777967 NY-ESO-1 tetramer(+) cells were detected concomitantly with high proportions of Treg but were distinct from the latter and displayed characteristics of TH1 effectors. PMID: 24777968 neck squamous cell carcinoma patients showing protein expression of MAGE-A family members or NY-ESO-1 represent a subgroup with an extraordinarily poor survival. PMID: 24482145 Our observations indicate a tight link of NY-ESO-1 expression to ERG activation PMID: 24789172 NY-ESO-1 and SP17 was not significantly associated with a specific histotype, but high-level GAGE expression was more frequent in squamous cell carcinoma. GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC. PMID: 24103781 NY-ESO-1 appears to be a sensitive and a specific marker for myxoid and round cell liposarcoma among mesenchymal myxoid neoplasms. PMID: 23599152 Positive results of immunohistostaining were obtained in 16 (35.6%), 7 (15.6%) and 36 (80.0%) samples using MAGE-C1, NY-ESO-1 and Sp17 antibodies, respectively PMID: 23923079 study analyzed NY-ESO-1 expression in 222 melanoma specimens including 16 primary and 206 metastatic tumors; results support previous findings showing higher expression of NY-ESO-1 in metastatic (58/206) versus primary (0/16) tumors; results also show epithelioid subtype of melanoma has the highest incidence of NY-ESO-1 expression PMID: 24290058 In two non epithelial cancers (glioma and mesothelioma), the epigenetic regulation of the NY-ESO-1 gene requires the sequential recruitment of the HDAC1-mSin3a-NCOR, Dnmt3b-HDAC1-Egr1 and Dnmt1-PCNA-UHRF1-G9a complexes. PMID: 23312906 Melanoma patients' humoral immune systems responded to NY-ESO-1 differently in each individual. PMID: 23454162 CTAG1B mRNA and protein are overexpressed with high frequency in myxoid and round cell liposarcoma PMID: 22936067 High CTAG1 expression and down-regulation of HLA class-I is associated with non-small cell lung cancer. PMID: 23645764 NY-ESO-1 is strongly and diffusely expressed in a majority of synovial sarcomas, but only rarely in other mesenchymal lesions. Suggest roles in targeted therapy and differential diagnosis. PMID: 22388761 The presence of circulating T cells responding to Melan-A or NY-ESO-1 had strong independent prognostic impact on survival in advanced melanoma. PMID: 22529253 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma. PMID: 22323448 Polymeric structure and TLR4 may play important roles in rendering NY-ESO-1 immunogenic and thus serve as a potent molecular adjuvant. NY-ESO-1 thus represents the first example of a cancer/testis antigen PMID: 21900253 Integrated NY-ESO-1 immune responses may have predictive value for ipilimumab treatment in patients with advanced metastatic melanoma. PMID: 21933959 Primary tumors with and without lymph node metastases showed no significant differences in MAGE-A 3/4 (P=0.672) and NY-ESO-1 (P=0.444) expression PMID: 21556122 LAGE-1a and NY-ESO-1 homology cannot be easily exploited in an anti-NY-ESO-1 vaccine given the low frequency of protein expression detected by IHC or serum analysis. PMID: 21247062 Report immunohistochemical expression of NY-ESO-1 in renal oncocytoma and chromophobe renal cell carcinoma. PMID: 20591578 Most melanoma patients with spontaneous NY-ESO-1-specific responses in this study exhibit spontaneous CD4-positive T cell responses to at least one of the three immunodominant LAGE-1 epitopes. PMID: 21131422 A versatile prime-boost vaccine strategy allows the generation of powerful, high-avidity tumor-associated immunodominant NY-ESO-1-transgene specific CD8-positive cytotoxic T cell responses. PMID: 20733200 tumor antigen NY-ESO-1 has a role in the immune responses to tumor and self-antigens PMID: 20368442 ESO 9V peptide isoform is more efficient in inducing conjugate formation and cytolytic granule polarization than the ESO 9L isoform. PMID: 20053942 MAGE-A3/6 and NY-ESO-1 were expressed in 50.0% (66/132) and 18.2% (24/132) of non-small-cell lung carcinomas, respectively. PMID: 19795170 High NY-ESO-1 expression is associated with oral squamous cell carcinoma. PMID: 20044626 Postvaccine T-cell clones are shown to recognize and lyse NY-ESO-1 expressing tumor cell lines in vitro. PMID: 19728336 NY-ESO-1 119-143 is a promiscuous major histocompatibility complex class II T-helper epitope recognized by Th1- and Th2-type tumor-reactive CD4+ T cells. PMID: 11782380 NY-ESO-1 is a marker that can be used to follow the early progression of testicular tumorigenesiswhen the tumors express a similar pattern to the cells of origin,although later tumors cease to express NY-ESO-1. PMID: 12065688 abilities of human monocyte-derived DCs and DCs derived in vitro from CD34-positive stem cells to present NY-ESO-1 epitopes to MHC class I-restricted cytotoxic T cells PMID: 12138174

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.