Recombinant Human C1GALT1 Protein
Beta LifeScience
SKU/CAT #: BLA-12486P
Recombinant Human C1GALT1 Protein
Beta LifeScience
SKU/CAT #: BLA-12486P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | Q9NS00 |
| Synonym | B3Gal T8 Beta 1 3 galactosyltransferase C1GALT Core 1 beta1 3 galactosyltransferase 1 Core 1 beta3 Gal T Core 1 O glycan T synthase Core 1 synthase glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1 Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1 3 galactosyltransferase Glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1 T synthase |
| Description | Recombinant Human C1GALT1 Protein was expressed in E.coli. It is a Protein fragment |
| Source | E.coli |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSLLGEKVDTQPNVLHNDPHARHSDDNGQ NHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKH VKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHE HYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGY MSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGD SRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAV SFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDT KVKLGNP |
| Molecular Weight | 41 kDa including tags |
| Purity | Greater than 80% SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
